Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1265159..1265381 Replicon chromosome
Accession NZ_CP064678
Organism Escherichia coli K-12 strain CETR3G40

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag IVL03_RS06185 Protein ID WP_000170963.1
Coordinates 1265159..1265266 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1265314..1265381 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IVL03_RS06155 1260468..1261550 + 1083 WP_000804726.1 peptide chain release factor 1 -
IVL03_RS06160 1261550..1262383 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
IVL03_RS06165 1262380..1262772 + 393 WP_000200374.1 invasion regulator SirB2 -
IVL03_RS06170 1262776..1263585 + 810 WP_001257044.1 invasion regulator SirB1 -
IVL03_RS06175 1263621..1264475 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IVL03_RS06180 1264624..1264731 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1264779..1264845 + 67 NuclAT_34 - -
- 1264779..1264845 + 67 NuclAT_34 - -
- 1264779..1264845 + 67 NuclAT_34 - -
- 1264779..1264845 + 67 NuclAT_34 - -
- 1264779..1264845 + 67 NuclAT_36 - -
- 1264779..1264845 + 67 NuclAT_36 - -
- 1264779..1264845 + 67 NuclAT_36 - -
- 1264779..1264845 + 67 NuclAT_36 - -
- 1264779..1264845 + 67 NuclAT_38 - -
- 1264779..1264845 + 67 NuclAT_38 - -
- 1264779..1264845 + 67 NuclAT_38 - -
- 1264779..1264845 + 67 NuclAT_38 - -
- 1264779..1264845 + 67 NuclAT_40 - -
- 1264779..1264845 + 67 NuclAT_40 - -
- 1264779..1264845 + 67 NuclAT_40 - -
- 1264779..1264845 + 67 NuclAT_40 - -
- 1264779..1264845 + 67 NuclAT_42 - -
- 1264779..1264845 + 67 NuclAT_42 - -
- 1264779..1264845 + 67 NuclAT_42 - -
- 1264779..1264845 + 67 NuclAT_42 - -
- 1264779..1264845 + 67 NuclAT_44 - -
- 1264779..1264845 + 67 NuclAT_44 - -
- 1264779..1264845 + 67 NuclAT_44 - -
- 1264779..1264845 + 67 NuclAT_44 - -
- 1264781..1264846 + 66 NuclAT_18 - -
- 1264781..1264846 + 66 NuclAT_18 - -
- 1264781..1264846 + 66 NuclAT_18 - -
- 1264781..1264846 + 66 NuclAT_18 - -
- 1264781..1264846 + 66 NuclAT_21 - -
- 1264781..1264846 + 66 NuclAT_21 - -
- 1264781..1264846 + 66 NuclAT_21 - -
- 1264781..1264846 + 66 NuclAT_21 - -
- 1264781..1264846 + 66 NuclAT_24 - -
- 1264781..1264846 + 66 NuclAT_24 - -
- 1264781..1264846 + 66 NuclAT_24 - -
- 1264781..1264846 + 66 NuclAT_24 - -
- 1264781..1264846 + 66 NuclAT_27 - -
- 1264781..1264846 + 66 NuclAT_27 - -
- 1264781..1264846 + 66 NuclAT_27 - -
- 1264781..1264846 + 66 NuclAT_27 - -
- 1264781..1264846 + 66 NuclAT_30 - -
- 1264781..1264846 + 66 NuclAT_30 - -
- 1264781..1264846 + 66 NuclAT_30 - -
- 1264781..1264846 + 66 NuclAT_30 - -
- 1264781..1264846 + 66 NuclAT_33 - -
- 1264781..1264846 + 66 NuclAT_33 - -
- 1264781..1264846 + 66 NuclAT_33 - -
- 1264781..1264846 + 66 NuclAT_33 - -
IVL03_RS06185 1265159..1265266 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1265314..1265381 + 68 NuclAT_17 - Antitoxin
- 1265314..1265381 + 68 NuclAT_17 - Antitoxin
- 1265314..1265381 + 68 NuclAT_17 - Antitoxin
- 1265314..1265381 + 68 NuclAT_17 - Antitoxin
- 1265314..1265381 + 68 NuclAT_20 - Antitoxin
- 1265314..1265381 + 68 NuclAT_20 - Antitoxin
- 1265314..1265381 + 68 NuclAT_20 - Antitoxin
- 1265314..1265381 + 68 NuclAT_20 - Antitoxin
- 1265314..1265381 + 68 NuclAT_23 - Antitoxin
- 1265314..1265381 + 68 NuclAT_23 - Antitoxin
- 1265314..1265381 + 68 NuclAT_23 - Antitoxin
- 1265314..1265381 + 68 NuclAT_23 - Antitoxin
- 1265314..1265381 + 68 NuclAT_26 - Antitoxin
- 1265314..1265381 + 68 NuclAT_26 - Antitoxin
- 1265314..1265381 + 68 NuclAT_26 - Antitoxin
- 1265314..1265381 + 68 NuclAT_26 - Antitoxin
- 1265314..1265381 + 68 NuclAT_29 - Antitoxin
- 1265314..1265381 + 68 NuclAT_29 - Antitoxin
- 1265314..1265381 + 68 NuclAT_29 - Antitoxin
- 1265314..1265381 + 68 NuclAT_29 - Antitoxin
- 1265314..1265381 + 68 NuclAT_32 - Antitoxin
- 1265314..1265381 + 68 NuclAT_32 - Antitoxin
- 1265314..1265381 + 68 NuclAT_32 - Antitoxin
- 1265314..1265381 + 68 NuclAT_32 - Antitoxin
- 1265315..1265380 + 66 NuclAT_35 - -
- 1265315..1265380 + 66 NuclAT_35 - -
- 1265315..1265380 + 66 NuclAT_35 - -
- 1265315..1265380 + 66 NuclAT_35 - -
- 1265315..1265380 + 66 NuclAT_37 - -
- 1265315..1265380 + 66 NuclAT_37 - -
- 1265315..1265380 + 66 NuclAT_37 - -
- 1265315..1265380 + 66 NuclAT_37 - -
- 1265315..1265380 + 66 NuclAT_39 - -
- 1265315..1265380 + 66 NuclAT_39 - -
- 1265315..1265380 + 66 NuclAT_39 - -
- 1265315..1265380 + 66 NuclAT_39 - -
- 1265315..1265380 + 66 NuclAT_41 - -
- 1265315..1265380 + 66 NuclAT_41 - -
- 1265315..1265380 + 66 NuclAT_41 - -
- 1265315..1265380 + 66 NuclAT_41 - -
- 1265315..1265380 + 66 NuclAT_43 - -
- 1265315..1265380 + 66 NuclAT_43 - -
- 1265315..1265380 + 66 NuclAT_43 - -
- 1265315..1265380 + 66 NuclAT_43 - -
- 1265315..1265380 + 66 NuclAT_45 - -
- 1265315..1265380 + 66 NuclAT_45 - -
- 1265315..1265380 + 66 NuclAT_45 - -
- 1265315..1265380 + 66 NuclAT_45 - -
IVL03_RS06190 1265694..1265801 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1265849..1265916 + 68 NuclAT_16 - -
- 1265849..1265916 + 68 NuclAT_16 - -
- 1265849..1265916 + 68 NuclAT_16 - -
- 1265849..1265916 + 68 NuclAT_16 - -
- 1265849..1265916 + 68 NuclAT_19 - -
- 1265849..1265916 + 68 NuclAT_19 - -
- 1265849..1265916 + 68 NuclAT_19 - -
- 1265849..1265916 + 68 NuclAT_19 - -
- 1265849..1265916 + 68 NuclAT_22 - -
- 1265849..1265916 + 68 NuclAT_22 - -
- 1265849..1265916 + 68 NuclAT_22 - -
- 1265849..1265916 + 68 NuclAT_22 - -
- 1265849..1265916 + 68 NuclAT_25 - -
- 1265849..1265916 + 68 NuclAT_25 - -
- 1265849..1265916 + 68 NuclAT_25 - -
- 1265849..1265916 + 68 NuclAT_25 - -
- 1265849..1265916 + 68 NuclAT_28 - -
- 1265849..1265916 + 68 NuclAT_28 - -
- 1265849..1265916 + 68 NuclAT_28 - -
- 1265849..1265916 + 68 NuclAT_28 - -
- 1265849..1265916 + 68 NuclAT_31 - -
- 1265849..1265916 + 68 NuclAT_31 - -
- 1265849..1265916 + 68 NuclAT_31 - -
- 1265849..1265916 + 68 NuclAT_31 - -
IVL03_RS06195 1266205..1267305 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
IVL03_RS06200 1267575..1267805 + 231 WP_001146444.1 putative cation transport regulator ChaB -
IVL03_RS06205 1267963..1268658 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
IVL03_RS06210 1268702..1269055 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T181415 WP_000170963.1 NZ_CP064678:c1265266-1265159 [Escherichia coli K-12]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T181415 NZ_CP085842:c1256763-1256656 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT181415 NZ_CP064678:1265314-1265381 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References