Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4529597..4530351 | Replicon | chromosome |
Accession | NZ_CP064674 | ||
Organism | Salmonella sp. SJTUF14076 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A4Y6MJG6 |
Locus tag | HU143_RS21715 | Protein ID | WP_000558165.1 |
Coordinates | 4529597..4529908 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | HU143_RS21720 | Protein ID | WP_001259009.1 |
Coordinates | 4529905..4530351 (+) | Length | 149 a.a. |
Genomic Context
Location: 4525263..4526165 (903 bp)
Type: Others
Protein ID: WP_051129234.1
Type: Others
Protein ID: WP_051129234.1
Location: 4526162..4526797 (636 bp)
Type: Others
Protein ID: WP_000829028.1
Type: Others
Protein ID: WP_000829028.1
Location: 4526794..4527723 (930 bp)
Type: Others
Protein ID: WP_000027730.1
Type: Others
Protein ID: WP_000027730.1
Location: 4528582..4529511 (930 bp)
Type: Others
Protein ID: WP_001162861.1
Type: Others
Protein ID: WP_001162861.1
Location: 4529597..4529908 (312 bp)
Type: Toxin
Protein ID: WP_000558165.1
Type: Toxin
Protein ID: WP_000558165.1
Location: 4529905..4530351 (447 bp)
Type: Antitoxin
Protein ID: WP_001259009.1
Type: Antitoxin
Protein ID: WP_001259009.1
Location: 4527761..4528135 (375 bp)
Type: Others
Protein ID: WP_000238494.1
Type: Others
Protein ID: WP_000238494.1
Location: 4528135..4528377 (243 bp)
Type: Others
Protein ID: WP_001523745.1
Type: Others
Protein ID: WP_001523745.1
Location: 4530366..4531307 (942 bp)
Type: Others
Protein ID: WP_001518251.1
Type: Others
Protein ID: WP_001518251.1
Location: 4531352..4531789 (438 bp)
Type: Others
Protein ID: WP_000560969.1
Type: Others
Protein ID: WP_000560969.1
Location: 4531786..4532658 (873 bp)
Type: Others
Protein ID: WP_000921423.1
Type: Others
Protein ID: WP_000921423.1
Location: 4532652..4533251 (600 bp)
Type: Others
Protein ID: WP_023227076.1
Type: Others
Protein ID: WP_023227076.1
Location: 4533442..4534245 (804 bp)
Type: Others
Protein ID: WP_000059689.1
Type: Others
Protein ID: WP_000059689.1
Location: 4534279..4535175 (897 bp)
Type: Others
Protein ID: WP_023227075.1
Type: Others
Protein ID: WP_023227075.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HU143_RS21685 | 4525263..4526165 | + | 903 | WP_051129234.1 | formate dehydrogenase subunit beta | - |
HU143_RS21690 | 4526162..4526797 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
HU143_RS21695 | 4526794..4527723 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
HU143_RS21700 | 4527761..4528135 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
HU143_RS21705 | 4528135..4528377 | - | 243 | WP_001523745.1 | ribbon-helix-helix domain-containing protein | - |
HU143_RS21710 | 4528582..4529511 | + | 930 | WP_001162861.1 | alpha/beta hydrolase | - |
HU143_RS21715 | 4529597..4529908 | + | 312 | WP_000558165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
HU143_RS21720 | 4529905..4530351 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
HU143_RS21725 | 4530366..4531307 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
HU143_RS21730 | 4531352..4531789 | - | 438 | WP_000560969.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
HU143_RS21735 | 4531786..4532658 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
HU143_RS21740 | 4532652..4533251 | - | 600 | WP_023227076.1 | glucose-1-phosphatase | - |
HU143_RS21745 | 4533442..4534245 | - | 804 | WP_000059689.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
HU143_RS21750 | 4534279..4535175 | - | 897 | WP_023227075.1 | sugar kinase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12433.34 Da Isoelectric Point: 8.4020
>T181409 WP_000558165.1 NZ_CP064674:4529597-4529908 [Salmonella sp. SJTUF14076]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
>T181409 NZ_CP085841:2790771-2790911 [Enterococcus faecalis]
ATTTCTCTGAAAAATACGAATAAAAATATCGTTTACTGTACAACATATGAAACAATTCAGACGATCCTAGGGTTTGGTAT
GTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
ATTTCTCTGAAAAATACGAATAAAAATATCGTTTACTGTACAACATATGAAACAATTCAGACGATCCTAGGGTTTGGTAT
GTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT181409 WP_001259009.1 NZ_CP064674:4529905-4530351 [Salmonella sp. SJTUF14076]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
>AT181409 NZ_CP085841:c2791042-2790844 [Enterococcus faecalis]
TTTTTAGGTAATTGTGCTATAATAGCAATGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGA
CGGTGACCAATTGTATTATTTAAAAATAACCGTACTGGTCAAAGTAAACGGTTATTTTTTCTTGTCATTTTTAAGCAATT
TCACAATCAGCGCAATCAAAGCAATGGTAAACATACCAA
TTTTTAGGTAATTGTGCTATAATAGCAATGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGA
CGGTGACCAATTGTATTATTTAAAAATAACCGTACTGGTCAAAGTAAACGGTTATTTTTTCTTGTCATTTTTAAGCAATT
TCACAATCAGCGCAATCAAAGCAATGGTAAACATACCAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y6MJG6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |