Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-pndB/Ldr(toxin)
Location 4982273..4982494 Replicon chromosome
Accession NZ_CP063774
Organism Escherichia coli O25b:H4-ST131

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag INT78_RS24060 Protein ID WP_001531632.1
Coordinates 4982273..4982380 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 4982428..4982494 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
INT78_RS24035 4978117..4979199 + 1083 WP_000804726.1 peptide chain release factor 1 -
INT78_RS24040 4979199..4980032 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
INT78_RS24045 4980029..4980421 + 393 WP_000200375.1 invasion regulator SirB2 -
INT78_RS24050 4980425..4981234 + 810 WP_001257044.1 invasion regulator SirB1 -
INT78_RS24055 4981270..4982124 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
INT78_RS24060 4982273..4982380 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4982428..4982494 + 67 NuclAT_10 - Antitoxin
- 4982428..4982494 + 67 NuclAT_10 - Antitoxin
- 4982428..4982494 + 67 NuclAT_10 - Antitoxin
- 4982428..4982494 + 67 NuclAT_10 - Antitoxin
- 4982428..4982494 + 67 NuclAT_5 - Antitoxin
- 4982428..4982494 + 67 NuclAT_5 - Antitoxin
- 4982428..4982494 + 67 NuclAT_5 - Antitoxin
- 4982428..4982494 + 67 NuclAT_5 - Antitoxin
- 4982428..4982494 + 67 NuclAT_6 - Antitoxin
- 4982428..4982494 + 67 NuclAT_6 - Antitoxin
- 4982428..4982494 + 67 NuclAT_6 - Antitoxin
- 4982428..4982494 + 67 NuclAT_6 - Antitoxin
- 4982428..4982494 + 67 NuclAT_7 - Antitoxin
- 4982428..4982494 + 67 NuclAT_7 - Antitoxin
- 4982428..4982494 + 67 NuclAT_7 - Antitoxin
- 4982428..4982494 + 67 NuclAT_7 - Antitoxin
- 4982428..4982494 + 67 NuclAT_8 - Antitoxin
- 4982428..4982494 + 67 NuclAT_8 - Antitoxin
- 4982428..4982494 + 67 NuclAT_8 - Antitoxin
- 4982428..4982494 + 67 NuclAT_8 - Antitoxin
- 4982428..4982494 + 67 NuclAT_9 - Antitoxin
- 4982428..4982494 + 67 NuclAT_9 - Antitoxin
- 4982428..4982494 + 67 NuclAT_9 - Antitoxin
- 4982428..4982494 + 67 NuclAT_9 - Antitoxin
- 4982430..4982493 + 64 NuclAT_14 - -
- 4982430..4982493 + 64 NuclAT_14 - -
- 4982430..4982493 + 64 NuclAT_14 - -
- 4982430..4982493 + 64 NuclAT_14 - -
- 4982430..4982493 + 64 NuclAT_15 - -
- 4982430..4982493 + 64 NuclAT_15 - -
- 4982430..4982493 + 64 NuclAT_15 - -
- 4982430..4982493 + 64 NuclAT_15 - -
- 4982430..4982493 + 64 NuclAT_16 - -
- 4982430..4982493 + 64 NuclAT_16 - -
- 4982430..4982493 + 64 NuclAT_16 - -
- 4982430..4982493 + 64 NuclAT_16 - -
- 4982430..4982493 + 64 NuclAT_17 - -
- 4982430..4982493 + 64 NuclAT_17 - -
- 4982430..4982493 + 64 NuclAT_17 - -
- 4982430..4982493 + 64 NuclAT_17 - -
- 4982430..4982493 + 64 NuclAT_18 - -
- 4982430..4982493 + 64 NuclAT_18 - -
- 4982430..4982493 + 64 NuclAT_18 - -
- 4982430..4982493 + 64 NuclAT_18 - -
- 4982430..4982493 + 64 NuclAT_19 - -
- 4982430..4982493 + 64 NuclAT_19 - -
- 4982430..4982493 + 64 NuclAT_19 - -
- 4982430..4982493 + 64 NuclAT_19 - -
- 4982430..4982495 + 66 NuclAT_20 - -
- 4982430..4982495 + 66 NuclAT_20 - -
- 4982430..4982495 + 66 NuclAT_20 - -
- 4982430..4982495 + 66 NuclAT_20 - -
- 4982430..4982495 + 66 NuclAT_21 - -
- 4982430..4982495 + 66 NuclAT_21 - -
- 4982430..4982495 + 66 NuclAT_21 - -
- 4982430..4982495 + 66 NuclAT_21 - -
- 4982430..4982495 + 66 NuclAT_22 - -
- 4982430..4982495 + 66 NuclAT_22 - -
- 4982430..4982495 + 66 NuclAT_22 - -
- 4982430..4982495 + 66 NuclAT_22 - -
- 4982430..4982495 + 66 NuclAT_23 - -
- 4982430..4982495 + 66 NuclAT_23 - -
- 4982430..4982495 + 66 NuclAT_23 - -
- 4982430..4982495 + 66 NuclAT_23 - -
- 4982430..4982495 + 66 NuclAT_24 - -
- 4982430..4982495 + 66 NuclAT_24 - -
- 4982430..4982495 + 66 NuclAT_24 - -
- 4982430..4982495 + 66 NuclAT_24 - -
- 4982430..4982495 + 66 NuclAT_25 - -
- 4982430..4982495 + 66 NuclAT_25 - -
- 4982430..4982495 + 66 NuclAT_25 - -
- 4982430..4982495 + 66 NuclAT_25 - -
INT78_RS24065 4982785..4983885 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
INT78_RS24070 4984155..4984394 + 240 WP_000120702.1 putative cation transport regulator ChaB -
INT78_RS24075 4984543..4985238 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
INT78_RS24080 4985282..4985635 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
INT78_RS24085 4985820..4987214 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T178816 WP_001531632.1 NZ_CP063774:c4982380-4982273 [Escherichia coli O25b:H4-ST131]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T178816 NZ_CP084313:1216063-1216365 [Bifidobacterium pseudolongum]
ATGGAGATTCGTACTACTGAGCAATTCGATAAATGGTTCCGCAAGTTGCGGGACCGCAAAGCAAAAGCCAAAATCAGCGC
ACGGCTCAGACAATGCGAAATCTCCGACCATATCACTGGAGATCATCATGGCATCGGCGGTGGCATAAGTGAAATGAGAT
TCCATTTTGGACCGGGATATCGTATCTACTACACCGTTGACAATGATGTGCTTGTTATTTTACTGATCGGAAGTGGTAAA
GACGATCAGTCCAGAGGGATTGCCGAAGCGAGAAAACTTCTTGCTTTATATCGAGGAGAATAA

Antitoxin


Download         Length: 67 bp

>AT178816 NZ_CP063774:4982428-4982494 [Escherichia coli O25b:H4-ST131]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9


Antitoxin

Download structure file

References