Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 128093..128335 | Replicon | plasmid pEH01-18-04-A_1 |
| Accession | NZ_CP063516 | ||
| Organism | Escherichia coli strain EH01-18-04-A | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | IQS17_RS25275 | Protein ID | WP_001312861.1 |
| Coordinates | 128177..128335 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 128093..128133 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IQS17_RS25255 | 123289..125247 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| IQS17_RS25260 | 125302..125736 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| IQS17_RS25265 | 125733..126452 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - | 126464..126650 | + | 187 | NuclAT_0 | - | - |
| - | 126464..126650 | + | 187 | NuclAT_0 | - | - |
| - | 126464..126650 | + | 187 | NuclAT_0 | - | - |
| - | 126464..126650 | + | 187 | NuclAT_0 | - | - |
| IQS17_RS25270 | 126698..128066 | + | 1369 | Protein_143 | IS3-like element IS150 family transposase | - |
| - | 128093..128133 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 128093..128133 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 128093..128133 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 128093..128133 | + | 41 | NuclAT_1 | - | Antitoxin |
| IQS17_RS25275 | 128177..128335 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| IQS17_RS25280 | 128778..129113 | + | 336 | WP_013023876.1 | hypothetical protein | - |
| IQS17_RS25285 | 129026..129232 | + | 207 | WP_000275859.1 | hypothetical protein | - |
| IQS17_RS25290 | 129257..129544 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| IQS17_RS25295 | 129663..130484 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| IQS17_RS25300 | 130781..131383 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| IQS17_RS25305 | 131714..132097 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| IQS17_RS25310 | 132231..132908 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| IQS17_RS25315 | 132996..133223 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..149434 | 149434 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T178639 WP_001312861.1 NZ_CP063516:128177-128335 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T178639 NZ_CP084205:c2370174-2369998 [Escherichia coli]
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATGGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATGGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA
Antitoxin
Download Length: 41 bp
>AT178639 NZ_CP063516:128093-128133 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|