178596

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 110883..111104 Replicon chromosome
Accession NZ_CP063515
Organism Escherichia coli strain EH01-18-04-A

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag IQS17_RS00610 Protein ID WP_001531632.1
Coordinates 110883..110990 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 111038..111104 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IQS17_RS00585 106727..107809 + 1083 WP_000804726.1 peptide chain release factor 1 -
IQS17_RS00590 107809..108642 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
IQS17_RS00595 108639..109031 + 393 WP_000200375.1 invasion regulator SirB2 -
IQS17_RS00600 109035..109844 + 810 WP_001257044.1 invasion regulator SirB1 -
IQS17_RS00605 109880..110734 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IQS17_RS00610 110883..110990 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 111038..111104 + 67 NuclAT_10 - Antitoxin
- 111038..111104 + 67 NuclAT_10 - Antitoxin
- 111038..111104 + 67 NuclAT_10 - Antitoxin
- 111038..111104 + 67 NuclAT_10 - Antitoxin
- 111038..111104 + 67 NuclAT_11 - Antitoxin
- 111038..111104 + 67 NuclAT_11 - Antitoxin
- 111038..111104 + 67 NuclAT_11 - Antitoxin
- 111038..111104 + 67 NuclAT_11 - Antitoxin
- 111038..111104 + 67 NuclAT_12 - Antitoxin
- 111038..111104 + 67 NuclAT_12 - Antitoxin
- 111038..111104 + 67 NuclAT_12 - Antitoxin
- 111038..111104 + 67 NuclAT_12 - Antitoxin
- 111038..111104 + 67 NuclAT_7 - Antitoxin
- 111038..111104 + 67 NuclAT_7 - Antitoxin
- 111038..111104 + 67 NuclAT_7 - Antitoxin
- 111038..111104 + 67 NuclAT_7 - Antitoxin
- 111038..111104 + 67 NuclAT_8 - Antitoxin
- 111038..111104 + 67 NuclAT_8 - Antitoxin
- 111038..111104 + 67 NuclAT_8 - Antitoxin
- 111038..111104 + 67 NuclAT_8 - Antitoxin
- 111038..111104 + 67 NuclAT_9 - Antitoxin
- 111038..111104 + 67 NuclAT_9 - Antitoxin
- 111038..111104 + 67 NuclAT_9 - Antitoxin
- 111038..111104 + 67 NuclAT_9 - Antitoxin
- 111040..111103 + 64 NuclAT_16 - -
- 111040..111103 + 64 NuclAT_16 - -
- 111040..111103 + 64 NuclAT_16 - -
- 111040..111103 + 64 NuclAT_16 - -
- 111040..111103 + 64 NuclAT_17 - -
- 111040..111103 + 64 NuclAT_17 - -
- 111040..111103 + 64 NuclAT_17 - -
- 111040..111103 + 64 NuclAT_17 - -
- 111040..111103 + 64 NuclAT_18 - -
- 111040..111103 + 64 NuclAT_18 - -
- 111040..111103 + 64 NuclAT_18 - -
- 111040..111103 + 64 NuclAT_18 - -
- 111040..111103 + 64 NuclAT_19 - -
- 111040..111103 + 64 NuclAT_19 - -
- 111040..111103 + 64 NuclAT_19 - -
- 111040..111103 + 64 NuclAT_19 - -
- 111040..111103 + 64 NuclAT_20 - -
- 111040..111103 + 64 NuclAT_20 - -
- 111040..111103 + 64 NuclAT_20 - -
- 111040..111103 + 64 NuclAT_20 - -
- 111040..111103 + 64 NuclAT_21 - -
- 111040..111103 + 64 NuclAT_21 - -
- 111040..111103 + 64 NuclAT_21 - -
- 111040..111103 + 64 NuclAT_21 - -
- 111040..111105 + 66 NuclAT_22 - -
- 111040..111105 + 66 NuclAT_22 - -
- 111040..111105 + 66 NuclAT_22 - -
- 111040..111105 + 66 NuclAT_22 - -
- 111040..111105 + 66 NuclAT_23 - -
- 111040..111105 + 66 NuclAT_23 - -
- 111040..111105 + 66 NuclAT_23 - -
- 111040..111105 + 66 NuclAT_23 - -
- 111040..111105 + 66 NuclAT_24 - -
- 111040..111105 + 66 NuclAT_24 - -
- 111040..111105 + 66 NuclAT_24 - -
- 111040..111105 + 66 NuclAT_24 - -
- 111040..111105 + 66 NuclAT_25 - -
- 111040..111105 + 66 NuclAT_25 - -
- 111040..111105 + 66 NuclAT_25 - -
- 111040..111105 + 66 NuclAT_25 - -
- 111040..111105 + 66 NuclAT_26 - -
- 111040..111105 + 66 NuclAT_26 - -
- 111040..111105 + 66 NuclAT_26 - -
- 111040..111105 + 66 NuclAT_26 - -
- 111040..111105 + 66 NuclAT_27 - -
- 111040..111105 + 66 NuclAT_27 - -
- 111040..111105 + 66 NuclAT_27 - -
- 111040..111105 + 66 NuclAT_27 - -
IQS17_RS00615 111395..112495 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
IQS17_RS00620 112765..113004 + 240 WP_000120702.1 putative cation transport regulator ChaB -
IQS17_RS00625 113153..113848 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
IQS17_RS00630 113892..114245 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
IQS17_RS00635 114430..115824 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T178596 WP_001531632.1 NZ_CP063515:c110990-110883 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T178596 NZ_CP084194:365014-365289 [Salmonella sp. A39]
ATGGGGCAAAGGGAAATTGAATATTCGGGACAGTTCCAGAAAGATGTAAAACGGGCACAAAAGCGTCATAAGGATGTCGG
CAAACTTAAAACACTTATGACGCTTCTGATTCACCACCCTTTTCCCCTTCCTGCCATTTATAAAGATCACCCGTTACAAG
GTTCATATAGCGGATACCGGGATGCCCATATTGAGCCTGACTGGATTCTTATTTATAAGATAACGGATGAATGCCTGCGA
TTTGAACGAACAGGAACGCATGCCGATTTATTTTAA

Antitoxin


Download         Length: 67 bp

>AT178596 NZ_CP063515:111038-111104 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References