Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2943418..2943639 Replicon chromosome
Accession NZ_CP063492
Organism Escherichia coli strain EF5-18-41

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag IQS14_RS14305 Protein ID WP_000170965.1
Coordinates 2943418..2943525 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2943573..2943639 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IQS14_RS14280 2939263..2940345 + 1083 WP_000804726.1 peptide chain release factor 1 -
IQS14_RS14285 2940345..2941178 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
IQS14_RS14290 2941175..2941567 + 393 WP_000151883.1 invasion regulator SirB2 -
IQS14_RS14295 2941571..2942380 + 810 WP_001257044.1 invasion regulator SirB1 -
IQS14_RS14300 2942416..2943270 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IQS14_RS14305 2943418..2943525 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2943573..2943639 + 67 NuclAT_16 - Antitoxin
- 2943573..2943639 + 67 NuclAT_16 - Antitoxin
- 2943573..2943639 + 67 NuclAT_16 - Antitoxin
- 2943573..2943639 + 67 NuclAT_16 - Antitoxin
- 2943573..2943639 + 67 NuclAT_18 - Antitoxin
- 2943573..2943639 + 67 NuclAT_18 - Antitoxin
- 2943573..2943639 + 67 NuclAT_18 - Antitoxin
- 2943573..2943639 + 67 NuclAT_18 - Antitoxin
- 2943573..2943639 + 67 NuclAT_20 - Antitoxin
- 2943573..2943639 + 67 NuclAT_20 - Antitoxin
- 2943573..2943639 + 67 NuclAT_20 - Antitoxin
- 2943573..2943639 + 67 NuclAT_20 - Antitoxin
- 2943573..2943639 + 67 NuclAT_22 - Antitoxin
- 2943573..2943639 + 67 NuclAT_22 - Antitoxin
- 2943573..2943639 + 67 NuclAT_22 - Antitoxin
- 2943573..2943639 + 67 NuclAT_22 - Antitoxin
- 2943573..2943639 + 67 NuclAT_24 - Antitoxin
- 2943573..2943639 + 67 NuclAT_24 - Antitoxin
- 2943573..2943639 + 67 NuclAT_24 - Antitoxin
- 2943573..2943639 + 67 NuclAT_24 - Antitoxin
- 2943573..2943639 + 67 NuclAT_26 - Antitoxin
- 2943573..2943639 + 67 NuclAT_26 - Antitoxin
- 2943573..2943639 + 67 NuclAT_26 - Antitoxin
- 2943573..2943639 + 67 NuclAT_26 - Antitoxin
- 2943575..2943638 + 64 NuclAT_29 - -
- 2943575..2943638 + 64 NuclAT_29 - -
- 2943575..2943638 + 64 NuclAT_29 - -
- 2943575..2943638 + 64 NuclAT_29 - -
- 2943575..2943638 + 64 NuclAT_31 - -
- 2943575..2943638 + 64 NuclAT_31 - -
- 2943575..2943638 + 64 NuclAT_31 - -
- 2943575..2943638 + 64 NuclAT_31 - -
- 2943575..2943638 + 64 NuclAT_33 - -
- 2943575..2943638 + 64 NuclAT_33 - -
- 2943575..2943638 + 64 NuclAT_33 - -
- 2943575..2943638 + 64 NuclAT_33 - -
- 2943575..2943638 + 64 NuclAT_35 - -
- 2943575..2943638 + 64 NuclAT_35 - -
- 2943575..2943638 + 64 NuclAT_35 - -
- 2943575..2943638 + 64 NuclAT_35 - -
- 2943575..2943638 + 64 NuclAT_37 - -
- 2943575..2943638 + 64 NuclAT_37 - -
- 2943575..2943638 + 64 NuclAT_37 - -
- 2943575..2943638 + 64 NuclAT_37 - -
- 2943575..2943638 + 64 NuclAT_39 - -
- 2943575..2943638 + 64 NuclAT_39 - -
- 2943575..2943638 + 64 NuclAT_39 - -
- 2943575..2943638 + 64 NuclAT_39 - -
- 2943575..2943640 + 66 NuclAT_41 - -
- 2943575..2943640 + 66 NuclAT_41 - -
- 2943575..2943640 + 66 NuclAT_41 - -
- 2943575..2943640 + 66 NuclAT_41 - -
IQS14_RS14310 2943953..2944060 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2944113..2944174 + 62 NuclAT_28 - -
- 2944113..2944174 + 62 NuclAT_28 - -
- 2944113..2944174 + 62 NuclAT_28 - -
- 2944113..2944174 + 62 NuclAT_28 - -
- 2944113..2944174 + 62 NuclAT_30 - -
- 2944113..2944174 + 62 NuclAT_30 - -
- 2944113..2944174 + 62 NuclAT_30 - -
- 2944113..2944174 + 62 NuclAT_30 - -
- 2944113..2944174 + 62 NuclAT_32 - -
- 2944113..2944174 + 62 NuclAT_32 - -
- 2944113..2944174 + 62 NuclAT_32 - -
- 2944113..2944174 + 62 NuclAT_32 - -
- 2944113..2944174 + 62 NuclAT_34 - -
- 2944113..2944174 + 62 NuclAT_34 - -
- 2944113..2944174 + 62 NuclAT_34 - -
- 2944113..2944174 + 62 NuclAT_34 - -
- 2944113..2944174 + 62 NuclAT_36 - -
- 2944113..2944174 + 62 NuclAT_36 - -
- 2944113..2944174 + 62 NuclAT_36 - -
- 2944113..2944174 + 62 NuclAT_36 - -
- 2944113..2944174 + 62 NuclAT_38 - -
- 2944113..2944174 + 62 NuclAT_38 - -
- 2944113..2944174 + 62 NuclAT_38 - -
- 2944113..2944174 + 62 NuclAT_38 - -
- 2944113..2944175 + 63 NuclAT_17 - -
- 2944113..2944175 + 63 NuclAT_17 - -
- 2944113..2944175 + 63 NuclAT_17 - -
- 2944113..2944175 + 63 NuclAT_17 - -
- 2944113..2944175 + 63 NuclAT_19 - -
- 2944113..2944175 + 63 NuclAT_19 - -
- 2944113..2944175 + 63 NuclAT_19 - -
- 2944113..2944175 + 63 NuclAT_19 - -
- 2944113..2944175 + 63 NuclAT_21 - -
- 2944113..2944175 + 63 NuclAT_21 - -
- 2944113..2944175 + 63 NuclAT_21 - -
- 2944113..2944175 + 63 NuclAT_21 - -
- 2944113..2944175 + 63 NuclAT_23 - -
- 2944113..2944175 + 63 NuclAT_23 - -
- 2944113..2944175 + 63 NuclAT_23 - -
- 2944113..2944175 + 63 NuclAT_23 - -
- 2944113..2944175 + 63 NuclAT_25 - -
- 2944113..2944175 + 63 NuclAT_25 - -
- 2944113..2944175 + 63 NuclAT_25 - -
- 2944113..2944175 + 63 NuclAT_25 - -
- 2944113..2944175 + 63 NuclAT_27 - -
- 2944113..2944175 + 63 NuclAT_27 - -
- 2944113..2944175 + 63 NuclAT_27 - -
- 2944113..2944175 + 63 NuclAT_27 - -
- 2944113..2944176 + 64 NuclAT_40 - -
- 2944113..2944176 + 64 NuclAT_40 - -
- 2944113..2944176 + 64 NuclAT_40 - -
- 2944113..2944176 + 64 NuclAT_40 - -
IQS14_RS14315 2944466..2945566 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
IQS14_RS14320 2945836..2946066 + 231 WP_001146444.1 putative cation transport regulator ChaB -
IQS14_RS14325 2946224..2946919 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
IQS14_RS14330 2946963..2947316 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T178482 WP_000170965.1 NZ_CP063492:c2943525-2943418 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T178482 NZ_CP084032:c1047161-1046946 [Pectobacterium colocasium]
GTGTATAGTCATACCACTATAGAAGCGCATGATCTGTCTGATAAAGTGAATAAGACGCTGTTCCCTCAGATCCGCATCAA
CGGCGAAGATTATCGATTGATTGCCACTGAGCTATCGAGCGTTCCCGTTGAGGTTATTGGTGAAGCTATCGCGGATCTTG
GCGAGTATGCCGATGAGATAAAGGATGCTATTAATCTTATTTTTGGGGGATTTTAG

Antitoxin


Download         Length: 67 bp

>AT178482 NZ_CP063492:2943573-2943639 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References