Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1921467..1921688 Replicon chromosome
Accession NZ_CP063153
Organism Escherichia coli strain M7424

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag INR48_RS09120 Protein ID WP_000170965.1
Coordinates 1921467..1921574 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1921622..1921688 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
INR48_RS09095 1917312..1918394 + 1083 WP_000804726.1 peptide chain release factor 1 -
INR48_RS09100 1918394..1919227 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
INR48_RS09105 1919224..1919616 + 393 WP_000151883.1 invasion regulator SirB2 -
INR48_RS09110 1919620..1920429 + 810 WP_001257044.1 invasion regulator SirB1 -
INR48_RS09115 1920465..1921319 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
INR48_RS09120 1921467..1921574 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1921622..1921688 + 67 NuclAT_14 - Antitoxin
- 1921622..1921688 + 67 NuclAT_14 - Antitoxin
- 1921622..1921688 + 67 NuclAT_14 - Antitoxin
- 1921622..1921688 + 67 NuclAT_14 - Antitoxin
- 1921622..1921688 + 67 NuclAT_16 - Antitoxin
- 1921622..1921688 + 67 NuclAT_16 - Antitoxin
- 1921622..1921688 + 67 NuclAT_16 - Antitoxin
- 1921622..1921688 + 67 NuclAT_16 - Antitoxin
- 1921622..1921688 + 67 NuclAT_18 - Antitoxin
- 1921622..1921688 + 67 NuclAT_18 - Antitoxin
- 1921622..1921688 + 67 NuclAT_18 - Antitoxin
- 1921622..1921688 + 67 NuclAT_18 - Antitoxin
- 1921622..1921688 + 67 NuclAT_20 - Antitoxin
- 1921622..1921688 + 67 NuclAT_20 - Antitoxin
- 1921622..1921688 + 67 NuclAT_20 - Antitoxin
- 1921622..1921688 + 67 NuclAT_20 - Antitoxin
- 1921622..1921688 + 67 NuclAT_22 - Antitoxin
- 1921622..1921688 + 67 NuclAT_22 - Antitoxin
- 1921622..1921688 + 67 NuclAT_22 - Antitoxin
- 1921622..1921688 + 67 NuclAT_22 - Antitoxin
- 1921622..1921688 + 67 NuclAT_24 - Antitoxin
- 1921622..1921688 + 67 NuclAT_24 - Antitoxin
- 1921622..1921688 + 67 NuclAT_24 - Antitoxin
- 1921622..1921688 + 67 NuclAT_24 - Antitoxin
- 1921624..1921687 + 64 NuclAT_27 - -
- 1921624..1921687 + 64 NuclAT_27 - -
- 1921624..1921687 + 64 NuclAT_27 - -
- 1921624..1921687 + 64 NuclAT_27 - -
- 1921624..1921687 + 64 NuclAT_29 - -
- 1921624..1921687 + 64 NuclAT_29 - -
- 1921624..1921687 + 64 NuclAT_29 - -
- 1921624..1921687 + 64 NuclAT_29 - -
- 1921624..1921687 + 64 NuclAT_31 - -
- 1921624..1921687 + 64 NuclAT_31 - -
- 1921624..1921687 + 64 NuclAT_31 - -
- 1921624..1921687 + 64 NuclAT_31 - -
- 1921624..1921687 + 64 NuclAT_33 - -
- 1921624..1921687 + 64 NuclAT_33 - -
- 1921624..1921687 + 64 NuclAT_33 - -
- 1921624..1921687 + 64 NuclAT_33 - -
- 1921624..1921687 + 64 NuclAT_35 - -
- 1921624..1921687 + 64 NuclAT_35 - -
- 1921624..1921687 + 64 NuclAT_35 - -
- 1921624..1921687 + 64 NuclAT_35 - -
- 1921624..1921687 + 64 NuclAT_37 - -
- 1921624..1921687 + 64 NuclAT_37 - -
- 1921624..1921687 + 64 NuclAT_37 - -
- 1921624..1921687 + 64 NuclAT_37 - -
- 1921624..1921689 + 66 NuclAT_39 - -
- 1921624..1921689 + 66 NuclAT_39 - -
- 1921624..1921689 + 66 NuclAT_39 - -
- 1921624..1921689 + 66 NuclAT_39 - -
- 1921624..1921689 + 66 NuclAT_41 - -
- 1921624..1921689 + 66 NuclAT_41 - -
- 1921624..1921689 + 66 NuclAT_41 - -
- 1921624..1921689 + 66 NuclAT_41 - -
- 1921624..1921689 + 66 NuclAT_43 - -
- 1921624..1921689 + 66 NuclAT_43 - -
- 1921624..1921689 + 66 NuclAT_43 - -
- 1921624..1921689 + 66 NuclAT_43 - -
INR48_RS09125 1922002..1922109 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1922162..1922223 + 62 NuclAT_26 - -
- 1922162..1922223 + 62 NuclAT_26 - -
- 1922162..1922223 + 62 NuclAT_26 - -
- 1922162..1922223 + 62 NuclAT_26 - -
- 1922162..1922223 + 62 NuclAT_28 - -
- 1922162..1922223 + 62 NuclAT_28 - -
- 1922162..1922223 + 62 NuclAT_28 - -
- 1922162..1922223 + 62 NuclAT_28 - -
- 1922162..1922223 + 62 NuclAT_30 - -
- 1922162..1922223 + 62 NuclAT_30 - -
- 1922162..1922223 + 62 NuclAT_30 - -
- 1922162..1922223 + 62 NuclAT_30 - -
- 1922162..1922223 + 62 NuclAT_32 - -
- 1922162..1922223 + 62 NuclAT_32 - -
- 1922162..1922223 + 62 NuclAT_32 - -
- 1922162..1922223 + 62 NuclAT_32 - -
- 1922162..1922223 + 62 NuclAT_34 - -
- 1922162..1922223 + 62 NuclAT_34 - -
- 1922162..1922223 + 62 NuclAT_34 - -
- 1922162..1922223 + 62 NuclAT_34 - -
- 1922162..1922223 + 62 NuclAT_36 - -
- 1922162..1922223 + 62 NuclAT_36 - -
- 1922162..1922223 + 62 NuclAT_36 - -
- 1922162..1922223 + 62 NuclAT_36 - -
- 1922162..1922224 + 63 NuclAT_15 - -
- 1922162..1922224 + 63 NuclAT_15 - -
- 1922162..1922224 + 63 NuclAT_15 - -
- 1922162..1922224 + 63 NuclAT_15 - -
- 1922162..1922224 + 63 NuclAT_17 - -
- 1922162..1922224 + 63 NuclAT_17 - -
- 1922162..1922224 + 63 NuclAT_17 - -
- 1922162..1922224 + 63 NuclAT_17 - -
- 1922162..1922224 + 63 NuclAT_19 - -
- 1922162..1922224 + 63 NuclAT_19 - -
- 1922162..1922224 + 63 NuclAT_19 - -
- 1922162..1922224 + 63 NuclAT_19 - -
- 1922162..1922224 + 63 NuclAT_21 - -
- 1922162..1922224 + 63 NuclAT_21 - -
- 1922162..1922224 + 63 NuclAT_21 - -
- 1922162..1922224 + 63 NuclAT_21 - -
- 1922162..1922224 + 63 NuclAT_23 - -
- 1922162..1922224 + 63 NuclAT_23 - -
- 1922162..1922224 + 63 NuclAT_23 - -
- 1922162..1922224 + 63 NuclAT_23 - -
- 1922162..1922224 + 63 NuclAT_25 - -
- 1922162..1922224 + 63 NuclAT_25 - -
- 1922162..1922224 + 63 NuclAT_25 - -
- 1922162..1922224 + 63 NuclAT_25 - -
- 1922162..1922225 + 64 NuclAT_38 - -
- 1922162..1922225 + 64 NuclAT_38 - -
- 1922162..1922225 + 64 NuclAT_38 - -
- 1922162..1922225 + 64 NuclAT_38 - -
- 1922162..1922225 + 64 NuclAT_40 - -
- 1922162..1922225 + 64 NuclAT_40 - -
- 1922162..1922225 + 64 NuclAT_40 - -
- 1922162..1922225 + 64 NuclAT_40 - -
- 1922162..1922225 + 64 NuclAT_42 - -
- 1922162..1922225 + 64 NuclAT_42 - -
- 1922162..1922225 + 64 NuclAT_42 - -
- 1922162..1922225 + 64 NuclAT_42 - -
INR48_RS09130 1922515..1923615 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
INR48_RS09135 1923885..1924115 + 231 WP_001146444.1 putative cation transport regulator ChaB -
INR48_RS09140 1924273..1924968 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
INR48_RS09145 1925012..1925365 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T177641 WP_000170965.1 NZ_CP063153:c1921574-1921467 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T177641 NZ_CP083610:c2601312-2600239 [Escherichia coli]
ATGACAATCAGGAGTTACAAAAACTTAAATCTGGTCAGGGCAAATATCGAGACTGAATCCAGACAATTCATTGAAAATAA
AAACTATTCAATCCAATCAATTGGTCCTATGCCAGGGTCAAGGGCTGGGCTTCGGGTCGTATTTACCAGACCAGGGGTTA
ACTTGGCAACTGTGGACATTTTTTATAACGGGGACGGTTCGACTACAATTCAATATCTCACTGGAGCCAATCGTTCTCTG
GGCCAAGAGTTAGCGGATCATCTTTTTGAAACCATCAATCCTGCTGAATTTGAGCAGGTAAATATGGTACTGCAAGGATT
TGTAGAGACAAGCGTTCTACCTGTACTTGAGCTATCAGCAGATGAATCGCATATAGAGTTCAGAGAACACTCTCGTAACG
CTCATACCGTAGTGTGGAAAATTATTTCCACCAGCTATCAGGACGAATTGACTGTGAGCCTGCATATCACAACAGGTAAG
CTCCAGATTCAGGGCCGACCGCTGTCATGTTACAGAGTTTTCACGTTTAACTTGGCAGCCCTGCTTGATTTACAGGGTTT
GGAGAAAGTGCTAATCCGCCAGGAGGATGGTAAAGCTAATATTGTTCAACAGGAGGTTGCCCGCACTTACTTGCAGACTG
TAATGGCCGATGCTTACCCGCATCTCCACGTGACTGCCGAAAAATTGCTCGTTTCAGGGCTATGTGTTAAACTCGCCGCC
CCTGATTTGCCTGACTACTGTATGTTACTTTATCCTGAACTACGCACCATTGAAGGTGTCTTAAAAAGTAAGATGAGTGG
GTTAGGCATGCCAGTACAGCAGCCGGCAGGTTTTGGAACTTACTTTGATAAACCTGCTGCTCATTACATTCTGAAACCGC
AATTTGCAGCTACTCTTAGACCGGAACAGATTAACATCATCAGCACAGCCTATACTTTTTTTAATGTGGAACGTCATTCT
CTGTTCCACATGGAAACTGTGGTCGATGCCAGCCGTATGATTTCTGATATGGCCCGGTTGATGGGTAAAGCCACTAGAGC
GTGGGGAATAATCAAGGACTTATATATTGTTTGA

Antitoxin


Download         Length: 67 bp

>AT177641 NZ_CP063153:1921622-1921688 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References