Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 1380787..1381196 | Replicon | chromosome |
Accession | NZ_CP063046 | ||
Organism | Escherichia coli strain KC-Dl-1 |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | IL980_RS06685 | Protein ID | WP_001534835.1 |
Coordinates | 1380858..1381196 (+) | Length | 113 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 1380787..1380863 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IL980_RS06675 | 1375975..1377285 | + | 1311 | WP_001534837.1 | restriction endonuclease subunit S | - |
IL980_RS06680 | 1377380..1380643 | + | 3264 | WP_001534836.1 | type I restriction endonuclease subunit R | - |
- | 1380787..1380863 | - | 77 | NuclAT_12 | - | Antitoxin |
- | 1380787..1380863 | - | 77 | NuclAT_12 | - | Antitoxin |
- | 1380787..1380863 | - | 77 | NuclAT_12 | - | Antitoxin |
- | 1380787..1380863 | - | 77 | NuclAT_12 | - | Antitoxin |
- | 1380787..1380863 | - | 77 | NuclAT_13 | - | Antitoxin |
- | 1380787..1380863 | - | 77 | NuclAT_13 | - | Antitoxin |
- | 1380787..1380863 | - | 77 | NuclAT_13 | - | Antitoxin |
- | 1380787..1380863 | - | 77 | NuclAT_13 | - | Antitoxin |
IL980_RS06685 | 1380858..1381196 | + | 339 | WP_001534835.1 | endoribonuclease SymE | Toxin |
IL980_RS06690 | 1381238..1381402 | - | 165 | Protein_1306 | DUF1127 domain-containing protein | - |
IL980_RS06695 | 1381580..1381750 | + | 171 | WP_000199350.1 | GntR family transcriptional regulator | - |
IL980_RS06700 | 1381880..1382800 | - | 921 | WP_000181193.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
IL980_RS06705 | 1382985..1384265 | + | 1281 | WP_001535800.1 | DUF445 domain-containing protein | - |
IL980_RS06710 | 1384381..1385532 | + | 1152 | WP_001338076.1 | 2-hydroxyacyl-CoA dehydratase subunit D | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12310.04 Da Isoelectric Point: 7.8226
>T177541 WP_001534835.1 NZ_CP063046:1380858-1381196 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYNRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQDFIGVISNKTPR
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYNRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQDFIGVISNKTPR
Download Length: 339 bp
>T177541 NZ_CP083530:c1612049-1611942 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 77 bp
>AT177541 NZ_CP063046:c1380863-1380787 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|