Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1888757..1888979 Replicon chromosome
Accession NZ_CP062865
Organism Escherichia coli O39:H21 strain Res13-Lact-PEB08-01

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag IMP90_RS09065 Protein ID WP_000170965.1
Coordinates 1888757..1888864 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1888912..1888979 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IMP90_RS09035 1884613..1885446 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
IMP90_RS09040 1885443..1885835 + 393 WP_000200378.1 invasion regulator SirB2 -
IMP90_RS09045 1885839..1886648 + 810 WP_001257044.1 invasion regulator SirB1 -
IMP90_RS09050 1886684..1887538 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IMP90_RS09055 1887687..1887794 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1887842..1887908 + 67 NuclAT_25 - -
- 1887842..1887908 + 67 NuclAT_25 - -
- 1887842..1887908 + 67 NuclAT_25 - -
- 1887842..1887908 + 67 NuclAT_25 - -
- 1887842..1887908 + 67 NuclAT_26 - -
- 1887842..1887908 + 67 NuclAT_26 - -
- 1887842..1887908 + 67 NuclAT_26 - -
- 1887842..1887908 + 67 NuclAT_26 - -
- 1887842..1887908 + 67 NuclAT_27 - -
- 1887842..1887908 + 67 NuclAT_27 - -
- 1887842..1887908 + 67 NuclAT_27 - -
- 1887842..1887908 + 67 NuclAT_27 - -
- 1887842..1887908 + 67 NuclAT_28 - -
- 1887842..1887908 + 67 NuclAT_28 - -
- 1887842..1887908 + 67 NuclAT_28 - -
- 1887842..1887908 + 67 NuclAT_28 - -
- 1887842..1887908 + 67 NuclAT_29 - -
- 1887842..1887908 + 67 NuclAT_29 - -
- 1887842..1887908 + 67 NuclAT_29 - -
- 1887842..1887908 + 67 NuclAT_29 - -
- 1887842..1887908 + 67 NuclAT_30 - -
- 1887842..1887908 + 67 NuclAT_30 - -
- 1887842..1887908 + 67 NuclAT_30 - -
- 1887842..1887908 + 67 NuclAT_30 - -
- 1887844..1887907 + 64 NuclAT_31 - -
- 1887844..1887907 + 64 NuclAT_31 - -
- 1887844..1887907 + 64 NuclAT_31 - -
- 1887844..1887907 + 64 NuclAT_31 - -
- 1887844..1887907 + 64 NuclAT_32 - -
- 1887844..1887907 + 64 NuclAT_32 - -
- 1887844..1887907 + 64 NuclAT_32 - -
- 1887844..1887907 + 64 NuclAT_32 - -
- 1887844..1887907 + 64 NuclAT_33 - -
- 1887844..1887907 + 64 NuclAT_33 - -
- 1887844..1887907 + 64 NuclAT_33 - -
- 1887844..1887907 + 64 NuclAT_33 - -
IMP90_RS09060 1888222..1888329 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1888377..1888444 + 68 NuclAT_13 - -
- 1888377..1888444 + 68 NuclAT_13 - -
- 1888377..1888444 + 68 NuclAT_13 - -
- 1888377..1888444 + 68 NuclAT_13 - -
- 1888377..1888444 + 68 NuclAT_15 - -
- 1888377..1888444 + 68 NuclAT_15 - -
- 1888377..1888444 + 68 NuclAT_15 - -
- 1888377..1888444 + 68 NuclAT_15 - -
- 1888377..1888444 + 68 NuclAT_17 - -
- 1888377..1888444 + 68 NuclAT_17 - -
- 1888377..1888444 + 68 NuclAT_17 - -
- 1888377..1888444 + 68 NuclAT_17 - -
- 1888377..1888444 + 68 NuclAT_19 - -
- 1888377..1888444 + 68 NuclAT_19 - -
- 1888377..1888444 + 68 NuclAT_19 - -
- 1888377..1888444 + 68 NuclAT_19 - -
- 1888377..1888444 + 68 NuclAT_21 - -
- 1888377..1888444 + 68 NuclAT_21 - -
- 1888377..1888444 + 68 NuclAT_21 - -
- 1888377..1888444 + 68 NuclAT_21 - -
- 1888377..1888444 + 68 NuclAT_23 - -
- 1888377..1888444 + 68 NuclAT_23 - -
- 1888377..1888444 + 68 NuclAT_23 - -
- 1888377..1888444 + 68 NuclAT_23 - -
IMP90_RS09065 1888757..1888864 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1888912..1888979 + 68 NuclAT_14 - Antitoxin
- 1888912..1888979 + 68 NuclAT_14 - Antitoxin
- 1888912..1888979 + 68 NuclAT_14 - Antitoxin
- 1888912..1888979 + 68 NuclAT_14 - Antitoxin
- 1888912..1888979 + 68 NuclAT_16 - Antitoxin
- 1888912..1888979 + 68 NuclAT_16 - Antitoxin
- 1888912..1888979 + 68 NuclAT_16 - Antitoxin
- 1888912..1888979 + 68 NuclAT_16 - Antitoxin
- 1888912..1888979 + 68 NuclAT_18 - Antitoxin
- 1888912..1888979 + 68 NuclAT_18 - Antitoxin
- 1888912..1888979 + 68 NuclAT_18 - Antitoxin
- 1888912..1888979 + 68 NuclAT_18 - Antitoxin
- 1888912..1888979 + 68 NuclAT_20 - Antitoxin
- 1888912..1888979 + 68 NuclAT_20 - Antitoxin
- 1888912..1888979 + 68 NuclAT_20 - Antitoxin
- 1888912..1888979 + 68 NuclAT_20 - Antitoxin
- 1888912..1888979 + 68 NuclAT_22 - Antitoxin
- 1888912..1888979 + 68 NuclAT_22 - Antitoxin
- 1888912..1888979 + 68 NuclAT_22 - Antitoxin
- 1888912..1888979 + 68 NuclAT_22 - Antitoxin
- 1888912..1888979 + 68 NuclAT_24 - Antitoxin
- 1888912..1888979 + 68 NuclAT_24 - Antitoxin
- 1888912..1888979 + 68 NuclAT_24 - Antitoxin
- 1888912..1888979 + 68 NuclAT_24 - Antitoxin
IMP90_RS09070 1889269..1890369 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
IMP90_RS09075 1890639..1890869 + 231 WP_001146442.1 putative cation transport regulator ChaB -
IMP90_RS09080 1891027..1891722 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
IMP90_RS09085 1891766..1892119 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
IMP90_RS09090 1892304..1893698 + 1395 WP_000086213.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T176958 WP_000170965.1 NZ_CP062865:c1888864-1888757 [Escherichia coli O39:H21]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T176958 NZ_CP083026:799463-799873 [Klebsiella pneumoniae]
GTGGTCCTGTGGCAATCTGATCTCCGTATCTCCTGGCGCGCGCAGTGGTTTTCCCTGCTGCTTCACGGCGTGGTGGCGGC
CCTGGTGCTGTTGGTTCCCTGGCCGCTGAGCTATACCCCGATCTGGCTGCTGCTGCTGTCGCTGGTGGTCTTCGACTGCG
TGCGCAGCCAGCGGCGGATCCATGCCCGTCGCGGGGAGATAAAACTGCTCACCGATTCCCGTCTTCGCTGGCAAAACGCC
GAATGGGAGATCCTCGGGACGCCGTGGGTTATCAATAGCGGTATGCTGCTGCGTTTGCGCCATGTCGATACCCGGCGCGG
ACAGCATCTTTGGCTGGCGGCGGACAGCATGGACGCCGGAGAGTGGCGCGATCTGCGCCGGCTGGTGCTGCAAAAACCGG
CGCAGGAGTAA

Antitoxin


Download         Length: 68 bp

>AT176958 NZ_CP062865:1888912-1888979 [Escherichia coli O39:H21]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References