Detailed information of TA system TA176767

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 78540..78794
• Replicon: plasmid unnamednovel_0
• Accession: NZ_CP062831
• Organism: Escherichia coli strain Res13-Lact-PER12-33-A

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: IMQ30_RS24490
• Protein ID: WP_032339099.1
• Coordinates: 78540..78746 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	78733..78794 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
IMQ30_RS24450	73578..74729	-	1152	WP_195686650.1	IS30-like element IS30 family transposase	-
IMQ30_RS24455	74797..75099	-	303	Protein_77	transposase	-
IMQ30_RS24460	75135..75332	-	198	Protein_78	3'-5' exonuclease	-
IMQ30_RS24465	75372..75653	-	282	WP_000969996.1	type II toxin-antitoxin system RelE/ParE family toxin	-
IMQ30_RS24470	75650..75919	-	270	WP_000079923.1	hypothetical protein	-
IMQ30_RS24475	76838..77694	-	857	Protein_81	incFII family plasmid replication initiator RepA	-
IMQ30_RS24480	77687..77761	-	75	WP_001365705.1	RepA leader peptide Tap	-
IMQ30_RS24485	78008..78256	-	249	WP_000083838.1	replication regulatory protein RepA	-
IMQ30_RS24490	78540..78746	-	207	WP_032339099.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	78733..78794	+	62	NuclAT_0	-	Antitoxin
-	78733..78794	+	62	NuclAT_0	-	Antitoxin
-	78733..78794	+	62	NuclAT_0	-	Antitoxin
-	78733..78794	+	62	NuclAT_0	-	Antitoxin
IMQ30_RS24495	78969..79352	-	384	Protein_85	hypothetical protein	-
IMQ30_RS24500	79470..79916	-	447	WP_032339098.1	thermonuclease family protein	-
IMQ30_RS24505	80054..81328	-	1275	Protein_87	IS66-like element ISEc23 family transposase	-
IMQ30_RS24515	82636..82980	-	345	Protein_89	IS66 family transposase	-
IMQ30_RS24520	83011..83361	-	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	-	1..141262	141262
	-	inside	IScluster/Tn	-	-	72663..86490	13827

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7808.29 Da
• Isoelectric Point: 8.8807

>T176767 WP_032339099.1 NZ_CP062831:c78746-78540 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYTLIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T176767 NZ_CP082929:1979088-1979190 [Salmonella enterica subsp. enterica serovar London]
GCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 62 bp

>AT176767 NZ_CP062831:78733-78794 [Escherichia coli]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin