Detailed information of TA system TA176648

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2757708..2757928
• Replicon: chromosome
• Accession: NZ_CP062811
• Organism: Escherichia coli strain Res13-Sevr-PER07-33

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: IMQ59_RS13280
• Protein ID: WP_000170963.1
• Coordinates: 2757821..2757928 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2757708..2757774 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
IMQ59_RS13255	2752986..2754380	-	1395	WP_000086192.1	inverse autotransporter invasin YchO	-
IMQ59_RS13260	2754566..2754919	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
IMQ59_RS13265	2754963..2755658	-	696	WP_024192029.1	glutathione-specific gamma-glutamylcyclotransferase	-
IMQ59_RS13270	2755816..2756046	-	231	WP_001146444.1	putative cation transport regulator ChaB	-
IMQ59_RS13275	2756316..2757416	+	1101	WP_021574581.1	sodium-potassium/proton antiporter ChaA	-
-	2757708..2757774	-	67	-	-	Antitoxin
IMQ59_RS13280	2757821..2757928	+	108	WP_000170963.1	small toxic polypeptide LdrB	Toxin
-	2758241..2758304	-	64	NuclAT_32	-	-
-	2758241..2758304	-	64	NuclAT_32	-	-
-	2758241..2758304	-	64	NuclAT_32	-	-
-	2758241..2758304	-	64	NuclAT_32	-	-
-	2758241..2758304	-	64	NuclAT_34	-	-
-	2758241..2758304	-	64	NuclAT_34	-	-
-	2758241..2758304	-	64	NuclAT_34	-	-
-	2758241..2758304	-	64	NuclAT_34	-	-
-	2758241..2758304	-	64	NuclAT_36	-	-
-	2758241..2758304	-	64	NuclAT_36	-	-
-	2758241..2758304	-	64	NuclAT_36	-	-
-	2758241..2758304	-	64	NuclAT_36	-	-
-	2758241..2758304	-	64	NuclAT_38	-	-
-	2758241..2758304	-	64	NuclAT_38	-	-
-	2758241..2758304	-	64	NuclAT_38	-	-
-	2758241..2758304	-	64	NuclAT_38	-	-
-	2758241..2758304	-	64	NuclAT_40	-	-
-	2758241..2758304	-	64	NuclAT_40	-	-
-	2758241..2758304	-	64	NuclAT_40	-	-
-	2758241..2758304	-	64	NuclAT_40	-	-
-	2758241..2758304	-	64	NuclAT_42	-	-
-	2758241..2758304	-	64	NuclAT_42	-	-
-	2758241..2758304	-	64	NuclAT_42	-	-
-	2758241..2758304	-	64	NuclAT_42	-	-
-	2758243..2758304	-	62	NuclAT_17	-	-
-	2758243..2758304	-	62	NuclAT_17	-	-
-	2758243..2758304	-	62	NuclAT_17	-	-
-	2758243..2758304	-	62	NuclAT_17	-	-
-	2758243..2758304	-	62	NuclAT_19	-	-
-	2758243..2758304	-	62	NuclAT_19	-	-
-	2758243..2758304	-	62	NuclAT_19	-	-
-	2758243..2758304	-	62	NuclAT_19	-	-
-	2758243..2758304	-	62	NuclAT_21	-	-
-	2758243..2758304	-	62	NuclAT_21	-	-
-	2758243..2758304	-	62	NuclAT_21	-	-
-	2758243..2758304	-	62	NuclAT_21	-	-
-	2758243..2758304	-	62	NuclAT_23	-	-
-	2758243..2758304	-	62	NuclAT_23	-	-
-	2758243..2758304	-	62	NuclAT_23	-	-
-	2758243..2758304	-	62	NuclAT_23	-	-
-	2758243..2758304	-	62	NuclAT_28	-	-
-	2758243..2758304	-	62	NuclAT_28	-	-
-	2758243..2758304	-	62	NuclAT_28	-	-
-	2758243..2758304	-	62	NuclAT_28	-	-
-	2758243..2758304	-	62	NuclAT_30	-	-
-	2758243..2758304	-	62	NuclAT_30	-	-
-	2758243..2758304	-	62	NuclAT_30	-	-
-	2758243..2758304	-	62	NuclAT_30	-	-
IMQ59_RS13285	2758357..2758464	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
IMQ59_RS13290	2758612..2759466	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
IMQ59_RS13295	2759502..2760311	-	810	WP_001257044.1	invasion regulator SirB1	-
IMQ59_RS13300	2760315..2760707	-	393	WP_001536881.1	invasion regulator SirB2	-
IMQ59_RS13305	2760704..2761537	-	834	WP_001536882.1	peptide chain release factor N(5)-glutamine methyltransferase	-
IMQ59_RS13310	2761537..2762619	-	1083	WP_000804726.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T176648 WP_000170963.1 NZ_CP062811:2757821-2757928 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T176648 NZ_CP082859:c4819948-4819529 [Gordonia bronchialis]
ATGCTTCTTGACATCAATGTTCTGGTGGCGCTGTCCTGGGATCAGCACGTCCATCACGGCGTCGCGCACGAGCGATTCGC
TCAGCTGACCGAATGGAGTACCTGTCCGGTCACGGAGGCGGGCCTGGTGCGGGTTCTCATGACCGAGTCGGCCGTCGGCC
GAGTGGTCACCGGGGCCGAGGCGCTCGGTCAGCTCGCAGCGCTGCGTACCGTCACTGGATGGGGTTTCCTCCACGACGAT
GCATCGCTCGCAGACTCGGTGATCGACCTGCGCGTCCTCATGGGACGACGTCAGGTGACCGACCTTCACCTGGTGAATCT
GGCTGCGCGCAATGGCCGGAAGCTGGCGACATTCGATGCCGGGTTGCGTGAATCGCTGGTGCCGGCGGACCGTGCGTGGG
TTGAGGTCTGGAGCGCTTAG

Antitoxin

Nucleotide

• Length: 67 bp

>AT176648 NZ_CP062811:c2757774-2757708 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin