Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 4822561..4822973 | Replicon | chromosome |
| Accession | NZ_CP062780 | ||
| Organism | Escherichia coli O157:H7 strain Z1769 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | Q8FA88 |
| Locus tag | ILQ49_RS24165 | Protein ID | WP_000132630.1 |
| Coordinates | 4822632..4822973 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 4822561..4822637 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILQ49_RS24155 | 4819188..4820657 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
| ILQ49_RS24155 | 4819188..4820657 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
| ILQ49_RS24160 | 4820657..4822411 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
| ILQ49_RS24160 | 4820657..4822411 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
| - | 4822561..4822637 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_15 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_15 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_15 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_15 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_15 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_15 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_15 | - | Antitoxin |
| - | 4822561..4822637 | - | 77 | NuclAT_15 | - | Antitoxin |
| ILQ49_RS24165 | 4822632..4822973 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
| ILQ49_RS24165 | 4822632..4822973 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
| ILQ49_RS24170 | 4823020..4824183 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
| ILQ49_RS24170 | 4823020..4824183 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
| ILQ49_RS24175 | 4824231..4825112 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
| ILQ49_RS24175 | 4824231..4825112 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
| ILQ49_RS24180 | 4825209..4825373 | - | 165 | WP_000394274.1 | DUF1127 domain-containing protein | - |
| ILQ49_RS24180 | 4825209..4825373 | - | 165 | WP_000394274.1 | DUF1127 domain-containing protein | - |
| ILQ49_RS24185 | 4825550..4826962 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
| ILQ49_RS24185 | 4825550..4826962 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
| ILQ49_RS24190 | 4827205..4827405 | - | 201 | WP_001310455.1 | hypothetical protein | - |
| ILQ49_RS24190 | 4827205..4827405 | - | 201 | WP_001310455.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | espX6 | 4814760..4835993 | 21233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T176556 WP_000132630.1 NZ_CP062780:4822632-4822973 [Escherichia coli O157:H7]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
>T176556 NZ_CP082833:c1117031-1116879 [Citrobacter rodentium NBRC 105723 = DSM 16636]
ATGCCGCAAAAATGTATATTATGCAGTTTAATAGTGATATGTCTCACTATATTATTATTTACCTGGATGGTTCGTGATTC
ATTATGCGAATTACATATCAGACAGGGCAATAATGAACTGGCGGCATTTTTAGCCTGTGAAGTGAAACAGTAA
ATGCCGCAAAAATGTATATTATGCAGTTTAATAGTGATATGTCTCACTATATTATTATTTACCTGGATGGTTCGTGATTC
ATTATGCGAATTACATATCAGACAGGGCAATAATGAACTGGCGGCATTTTTAGCCTGTGAAGTGAAACAGTAA
Antitoxin
Download Length: 77 bp
>AT176556 NZ_CP062780:c4822637-4822561 [Escherichia coli O157:H7]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|