Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3572713..3572938 | Replicon | chromosome |
Accession | NZ_CP062780 | ||
Organism | Escherichia coli O157:H7 strain Z1769 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | ILQ49_RS18355 | Protein ID | WP_000813263.1 |
Coordinates | 3572713..3572868 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3572880..3572938 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ49_RS18320 | 3568167..3568880 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
ILQ49_RS18325 | 3569018..3569214 | - | 197 | Protein_3586 | TrmB family transcriptional regulator | - |
ILQ49_RS18330 | 3569501..3570319 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
ILQ49_RS18335 | 3570471..3570842 | - | 372 | WP_000090264.1 | antitermination protein | - |
ILQ49_RS18340 | 3570832..3571203 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ49_RS18345 | 3571216..3572265 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
ILQ49_RS18350 | 3572267..3572545 | - | 279 | WP_001341388.1 | hypothetical protein | - |
ILQ49_RS18355 | 3572713..3572868 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3572880..3572938 | + | 59 | - | - | Antitoxin |
ILQ49_RS18360 | 3573473..3574246 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
ILQ49_RS18365 | 3574598..3575011 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
ILQ49_RS18370 | 3575027..3575797 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
ILQ49_RS18375 | 3575819..3576565 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
ILQ49_RS18380 | 3576572..3577663 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T176548 WP_000813263.1 NZ_CP062780:c3572868-3572713 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T176548 NZ_CP082831:c4923433-4923260 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTTTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTTTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 59 bp
>AT176548 NZ_CP062780:3572880-3572938 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|