Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2645885..2646110 | Replicon | chromosome |
Accession | NZ_CP062780 | ||
Organism | Escherichia coli O157:H7 strain Z1769 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | ILQ49_RS13430 | Protein ID | WP_000813258.1 |
Coordinates | 2645955..2646110 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2645885..2645943 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ49_RS13380 | 2640950..2641192 | + | 243 | WP_000747948.1 | hypothetical protein | - |
ILQ49_RS13385 | 2641176..2641601 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
ILQ49_RS13390 | 2641670..2642713 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
ILQ49_RS13395 | 2642706..2643167 | + | 462 | WP_000139447.1 | replication protein | - |
ILQ49_RS13400 | 2643201..2643917 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
ILQ49_RS13405 | 2643950..2644231 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
ILQ49_RS13410 | 2644228..2644455 | + | 228 | WP_000699809.1 | hypothetical protein | - |
ILQ49_RS13415 | 2644448..2644759 | + | 312 | WP_001289673.1 | hypothetical protein | - |
ILQ49_RS13420 | 2644887..2645105 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
ILQ49_RS13425 | 2645107..2645664 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2645885..2645943 | - | 59 | - | - | Antitoxin |
ILQ49_RS13430 | 2645955..2646110 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
ILQ49_RS13435 | 2646230..2646574 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
ILQ49_RS13440 | 2646696..2646968 | + | 273 | WP_000191872.1 | hypothetical protein | - |
ILQ49_RS13445 | 2646970..2648019 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
ILQ49_RS13450 | 2648032..2648337 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ49_RS13455 | 2648400..2648954 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
ILQ49_RS13460 | 2649179..2649376 | + | 198 | WP_000917763.1 | hypothetical protein | - |
ILQ49_RS13465 | 2649512..2650225 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
ILQ49_RS13480 | 2650676..2651107 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | nleG7' | 2629893..2650225 | 20332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T176543 WP_000813258.1 NZ_CP062780:2645955-2646110 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T176543 NZ_CP082831:c4234030-4233746 [Escherichia coli]
ATGCAATTTACGGTATACCGCAGTCGCGGCAGGAACGCCGCGTTTCCCTTTGTTATTGATGTTACCAGCGACATTATTGG
TGAGATTAATCGCCGTATCGTTATTCCATTAACACCTATTGAACGATTTAGCCGTATTCGCCCACCAGAACGGCTTAACC
CAATCCTTTTACTGATAGACGGCAAAGAATATGTGCTCATGACGCATGAGACTGCAACTGTTCCAGTTAACGCGCTGGGA
ACGAAATTTTGCGATGCCAGCGCGCACCGAACGTTGATTAAATGA
ATGCAATTTACGGTATACCGCAGTCGCGGCAGGAACGCCGCGTTTCCCTTTGTTATTGATGTTACCAGCGACATTATTGG
TGAGATTAATCGCCGTATCGTTATTCCATTAACACCTATTGAACGATTTAGCCGTATTCGCCCACCAGAACGGCTTAACC
CAATCCTTTTACTGATAGACGGCAAAGAATATGTGCTCATGACGCATGAGACTGCAACTGTTCCAGTTAACGCGCTGGGA
ACGAAATTTTGCGATGCCAGCGCGCACCGAACGTTGATTAAATGA
Antitoxin
Download Length: 59 bp
>AT176543 NZ_CP062780:c2645943-2645885 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|