Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4849518..4849930 | Replicon | chromosome |
Accession | NZ_CP062778 | ||
Organism | Escherichia coli O157:H7 strain Z1836 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | ILQ64_RS24410 | Protein ID | WP_000132630.1 |
Coordinates | 4849589..4849930 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4849518..4849594 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ64_RS24400 | 4846145..4847614 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
ILQ64_RS24405 | 4847614..4849368 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
- | 4849518..4849594 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4849518..4849594 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4849518..4849594 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4849518..4849594 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4849518..4849594 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4849518..4849594 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4849518..4849594 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4849518..4849594 | - | 77 | NuclAT_15 | - | Antitoxin |
ILQ64_RS24410 | 4849589..4849930 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
ILQ64_RS24415 | 4849977..4851140 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
ILQ64_RS24420 | 4851188..4852069 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
ILQ64_RS24425 | 4852166..4852330 | - | 165 | WP_000394274.1 | DUF1127 domain-containing protein | - |
ILQ64_RS24430 | 4852507..4853919 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
ILQ64_RS24435 | 4854162..4854362 | - | 201 | WP_001310455.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | espX6 | 4841717..4862941 | 21224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T176520 WP_000132630.1 NZ_CP062778:4849589-4849930 [Escherichia coli O157:H7]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
>T176520 NZ_CP082827:4295732-4295884 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 77 bp
>AT176520 NZ_CP062778:c4849594-4849518 [Escherichia coli O157:H7]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|