Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4861833..4862245 | Replicon | chromosome |
Accession | NZ_CP062771 | ||
Organism | Escherichia coli O157:H7 strain Z570 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | ILQ32_RS24430 | Protein ID | WP_000132630.1 |
Coordinates | 4861904..4862245 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4861833..4861909 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ32_RS24420 | 4858460..4859929 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
ILQ32_RS24425 | 4859929..4861683 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
- | 4861833..4861909 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4861833..4861909 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4861833..4861909 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4861833..4861909 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4861833..4861909 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4861833..4861909 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4861833..4861909 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4861833..4861909 | - | 77 | NuclAT_15 | - | Antitoxin |
ILQ32_RS24430 | 4861904..4862245 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
ILQ32_RS24435 | 4862292..4863455 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
ILQ32_RS24440 | 4863503..4864384 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
ILQ32_RS24445 | 4864481..4864645 | - | 165 | WP_000394274.1 | DUF1127 domain-containing protein | - |
ILQ32_RS24450 | 4864822..4866234 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
ILQ32_RS24455 | 4866477..4866677 | - | 201 | WP_001310455.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | espX6 | 4854032..4875259 | 21227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T176443 WP_000132630.1 NZ_CP062771:4861904-4862245 [Escherichia coli O157:H7]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
>T176443 NZ_CP082815:c2581539-2581432 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 77 bp
>AT176443 NZ_CP062771:c4861909-4861833 [Escherichia coli O157:H7]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|