Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3621341..3621566 | Replicon | chromosome |
Accession | NZ_CP062771 | ||
Organism | Escherichia coli O157:H7 strain Z570 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | ILQ32_RS18700 | Protein ID | WP_000813263.1 |
Coordinates | 3621341..3621496 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3621508..3621566 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ32_RS18665 | 3616795..3617508 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
ILQ32_RS18670 | 3617646..3617842 | - | 197 | Protein_3655 | TrmB family transcriptional regulator | - |
ILQ32_RS18675 | 3618129..3618947 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
ILQ32_RS18680 | 3619099..3619470 | - | 372 | WP_000090264.1 | antitermination protein | - |
ILQ32_RS18685 | 3619460..3619831 | - | 372 | WP_032283490.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ32_RS18690 | 3619844..3620893 | - | 1050 | WP_206338758.1 | DUF968 domain-containing protein | - |
ILQ32_RS18695 | 3620895..3621173 | - | 279 | WP_001341388.1 | hypothetical protein | - |
ILQ32_RS18700 | 3621341..3621496 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3621508..3621566 | + | 59 | - | - | Antitoxin |
ILQ32_RS18705 | 3622101..3622874 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
ILQ32_RS18710 | 3623226..3623639 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
ILQ32_RS18715 | 3623655..3624425 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
ILQ32_RS18720 | 3624447..3625193 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
ILQ32_RS18725 | 3625200..3626291 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T176435 WP_000813263.1 NZ_CP062771:c3621496-3621341 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T176435 NZ_CP082815:c1925841-1925689 [Staphylococcus aureus]
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACTGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATTTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACTGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATTTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA
Antitoxin
Download Length: 59 bp
>AT176435 NZ_CP062771:3621508-3621566 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|