Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2207876..2208090 Replicon chromosome
Accession NZ_CP062763
Organism Escherichia coli O157:H7 strain Z885

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ILQ36_RS11070 Protein ID WP_000170963.1
Coordinates 2207876..2207983 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2208031..2208090 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ILQ36_RS11040 2203185..2204267 + 1083 WP_000804726.1 peptide chain release factor 1 -
ILQ36_RS11045 2204267..2205100 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
ILQ36_RS11050 2205097..2205489 + 393 WP_000200380.1 invasion regulator SirB2 -
ILQ36_RS11055 2205493..2206302 + 810 WP_001257044.1 invasion regulator SirB1 -
ILQ36_RS11060 2206338..2207192 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
ILQ36_RS11065 2207340..2207447 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2207500..2207561 + 62 NuclAT_24 - -
- 2207500..2207561 + 62 NuclAT_24 - -
- 2207500..2207561 + 62 NuclAT_24 - -
- 2207500..2207561 + 62 NuclAT_24 - -
- 2207500..2207561 + 62 NuclAT_26 - -
- 2207500..2207561 + 62 NuclAT_26 - -
- 2207500..2207561 + 62 NuclAT_26 - -
- 2207500..2207561 + 62 NuclAT_26 - -
- 2207500..2207561 + 62 NuclAT_28 - -
- 2207500..2207561 + 62 NuclAT_28 - -
- 2207500..2207561 + 62 NuclAT_28 - -
- 2207500..2207561 + 62 NuclAT_28 - -
- 2207500..2207561 + 62 NuclAT_30 - -
- 2207500..2207561 + 62 NuclAT_30 - -
- 2207500..2207561 + 62 NuclAT_30 - -
- 2207500..2207561 + 62 NuclAT_30 - -
- 2207500..2207561 + 62 NuclAT_32 - -
- 2207500..2207561 + 62 NuclAT_32 - -
- 2207500..2207561 + 62 NuclAT_32 - -
- 2207500..2207561 + 62 NuclAT_32 - -
- 2207500..2207562 + 63 NuclAT_17 - -
- 2207500..2207562 + 63 NuclAT_17 - -
- 2207500..2207562 + 63 NuclAT_17 - -
- 2207500..2207562 + 63 NuclAT_17 - -
- 2207500..2207562 + 63 NuclAT_18 - -
- 2207500..2207562 + 63 NuclAT_18 - -
- 2207500..2207562 + 63 NuclAT_18 - -
- 2207500..2207562 + 63 NuclAT_18 - -
- 2207500..2207562 + 63 NuclAT_19 - -
- 2207500..2207562 + 63 NuclAT_19 - -
- 2207500..2207562 + 63 NuclAT_19 - -
- 2207500..2207562 + 63 NuclAT_19 - -
- 2207500..2207562 + 63 NuclAT_20 - -
- 2207500..2207562 + 63 NuclAT_20 - -
- 2207500..2207562 + 63 NuclAT_20 - -
- 2207500..2207562 + 63 NuclAT_20 - -
- 2207500..2207562 + 63 NuclAT_22 - -
- 2207500..2207562 + 63 NuclAT_22 - -
- 2207500..2207562 + 63 NuclAT_22 - -
- 2207500..2207562 + 63 NuclAT_22 - -
- 2207500..2207562 + 63 NuclAT_23 - -
- 2207500..2207562 + 63 NuclAT_23 - -
- 2207500..2207562 + 63 NuclAT_23 - -
- 2207500..2207562 + 63 NuclAT_23 - -
ILQ36_RS11070 2207876..2207983 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2208031..2208090 + 60 NuclAT_25 - Antitoxin
- 2208031..2208090 + 60 NuclAT_25 - Antitoxin
- 2208031..2208090 + 60 NuclAT_25 - Antitoxin
- 2208031..2208090 + 60 NuclAT_25 - Antitoxin
- 2208031..2208090 + 60 NuclAT_27 - Antitoxin
- 2208031..2208090 + 60 NuclAT_27 - Antitoxin
- 2208031..2208090 + 60 NuclAT_27 - Antitoxin
- 2208031..2208090 + 60 NuclAT_27 - Antitoxin
- 2208031..2208090 + 60 NuclAT_29 - Antitoxin
- 2208031..2208090 + 60 NuclAT_29 - Antitoxin
- 2208031..2208090 + 60 NuclAT_29 - Antitoxin
- 2208031..2208090 + 60 NuclAT_29 - Antitoxin
- 2208031..2208090 + 60 NuclAT_31 - Antitoxin
- 2208031..2208090 + 60 NuclAT_31 - Antitoxin
- 2208031..2208090 + 60 NuclAT_31 - Antitoxin
- 2208031..2208090 + 60 NuclAT_31 - Antitoxin
- 2208031..2208090 + 60 NuclAT_33 - Antitoxin
- 2208031..2208090 + 60 NuclAT_33 - Antitoxin
- 2208031..2208090 + 60 NuclAT_33 - Antitoxin
- 2208031..2208090 + 60 NuclAT_33 - Antitoxin
ILQ36_RS11075 2208382..2209482 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
ILQ36_RS11080 2209752..2209982 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ILQ36_RS11085 2210143..2210838 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
ILQ36_RS11090 2210882..2211235 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
ILQ36_RS11095 2211421..2212815 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T176317 WP_000170963.1 NZ_CP062763:c2207983-2207876 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T176317 NZ_CP082777:c2903249-2903147 [Escherichia coli O25:H1]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT

Antitoxin


Download         Length: 60 bp

>AT176317 NZ_CP062763:2208031-2208090 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References