Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2884335..2884560 | Replicon | chromosome |
| Accession | NZ_CP062761 | ||
| Organism | Escherichia coli O157:H7 strain Z887 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | ILQ37_RS14790 | Protein ID | WP_000813258.1 |
| Coordinates | 2884405..2884560 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2884335..2884393 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILQ37_RS14740 | 2879400..2879642 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| ILQ37_RS14745 | 2879626..2880051 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| ILQ37_RS14750 | 2880120..2881163 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| ILQ37_RS14755 | 2881156..2881617 | + | 462 | WP_000139447.1 | replication protein | - |
| ILQ37_RS14760 | 2881651..2882367 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| ILQ37_RS14765 | 2882400..2882681 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| ILQ37_RS14770 | 2882678..2882905 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| ILQ37_RS14775 | 2882898..2883209 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| ILQ37_RS14780 | 2883337..2883555 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| ILQ37_RS14785 | 2883557..2884114 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 2884335..2884393 | - | 59 | - | - | Antitoxin |
| ILQ37_RS14790 | 2884405..2884560 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ILQ37_RS14795 | 2884680..2885024 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| ILQ37_RS14800 | 2885146..2885418 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| ILQ37_RS14805 | 2885420..2886469 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| ILQ37_RS14810 | 2886482..2886787 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ILQ37_RS14815 | 2886850..2887404 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| ILQ37_RS14820 | 2887629..2887826 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| ILQ37_RS14825 | 2887962..2888675 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| ILQ37_RS14840 | 2889126..2889557 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | paa / nleG7' | 2773515..2928474 | 154959 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T176290 WP_000813258.1 NZ_CP062761:2884405-2884560 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T176290 NZ_CP082776:476188-476361 [Escherichia coli O4:H5]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 59 bp
>AT176290 NZ_CP062761:c2884393-2884335 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|