Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2735686..2735900 Replicon chromosome
Accession NZ_CP062761
Organism Escherichia coli O157:H7 strain Z887

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ILQ37_RS13880 Protein ID WP_000170963.1
Coordinates 2735686..2735793 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2735841..2735900 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ILQ37_RS13850 2730995..2732077 + 1083 WP_000804726.1 peptide chain release factor 1 -
ILQ37_RS13855 2732077..2732910 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
ILQ37_RS13860 2732907..2733299 + 393 WP_000200380.1 invasion regulator SirB2 -
ILQ37_RS13865 2733303..2734112 + 810 WP_001257044.1 invasion regulator SirB1 -
ILQ37_RS13870 2734148..2735002 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
ILQ37_RS13875 2735150..2735257 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2735310..2735371 + 62 NuclAT_24 - -
- 2735310..2735371 + 62 NuclAT_24 - -
- 2735310..2735371 + 62 NuclAT_24 - -
- 2735310..2735371 + 62 NuclAT_24 - -
- 2735310..2735371 + 62 NuclAT_26 - -
- 2735310..2735371 + 62 NuclAT_26 - -
- 2735310..2735371 + 62 NuclAT_26 - -
- 2735310..2735371 + 62 NuclAT_26 - -
- 2735310..2735371 + 62 NuclAT_28 - -
- 2735310..2735371 + 62 NuclAT_28 - -
- 2735310..2735371 + 62 NuclAT_28 - -
- 2735310..2735371 + 62 NuclAT_28 - -
- 2735310..2735371 + 62 NuclAT_30 - -
- 2735310..2735371 + 62 NuclAT_30 - -
- 2735310..2735371 + 62 NuclAT_30 - -
- 2735310..2735371 + 62 NuclAT_30 - -
- 2735310..2735371 + 62 NuclAT_32 - -
- 2735310..2735371 + 62 NuclAT_32 - -
- 2735310..2735371 + 62 NuclAT_32 - -
- 2735310..2735371 + 62 NuclAT_32 - -
- 2735310..2735372 + 63 NuclAT_17 - -
- 2735310..2735372 + 63 NuclAT_17 - -
- 2735310..2735372 + 63 NuclAT_17 - -
- 2735310..2735372 + 63 NuclAT_17 - -
- 2735310..2735372 + 63 NuclAT_18 - -
- 2735310..2735372 + 63 NuclAT_18 - -
- 2735310..2735372 + 63 NuclAT_18 - -
- 2735310..2735372 + 63 NuclAT_18 - -
- 2735310..2735372 + 63 NuclAT_19 - -
- 2735310..2735372 + 63 NuclAT_19 - -
- 2735310..2735372 + 63 NuclAT_19 - -
- 2735310..2735372 + 63 NuclAT_19 - -
- 2735310..2735372 + 63 NuclAT_20 - -
- 2735310..2735372 + 63 NuclAT_20 - -
- 2735310..2735372 + 63 NuclAT_20 - -
- 2735310..2735372 + 63 NuclAT_20 - -
- 2735310..2735372 + 63 NuclAT_22 - -
- 2735310..2735372 + 63 NuclAT_22 - -
- 2735310..2735372 + 63 NuclAT_22 - -
- 2735310..2735372 + 63 NuclAT_22 - -
- 2735310..2735372 + 63 NuclAT_23 - -
- 2735310..2735372 + 63 NuclAT_23 - -
- 2735310..2735372 + 63 NuclAT_23 - -
- 2735310..2735372 + 63 NuclAT_23 - -
ILQ37_RS13880 2735686..2735793 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2735841..2735900 + 60 NuclAT_25 - Antitoxin
- 2735841..2735900 + 60 NuclAT_25 - Antitoxin
- 2735841..2735900 + 60 NuclAT_25 - Antitoxin
- 2735841..2735900 + 60 NuclAT_25 - Antitoxin
- 2735841..2735900 + 60 NuclAT_27 - Antitoxin
- 2735841..2735900 + 60 NuclAT_27 - Antitoxin
- 2735841..2735900 + 60 NuclAT_27 - Antitoxin
- 2735841..2735900 + 60 NuclAT_27 - Antitoxin
- 2735841..2735900 + 60 NuclAT_29 - Antitoxin
- 2735841..2735900 + 60 NuclAT_29 - Antitoxin
- 2735841..2735900 + 60 NuclAT_29 - Antitoxin
- 2735841..2735900 + 60 NuclAT_29 - Antitoxin
- 2735841..2735900 + 60 NuclAT_31 - Antitoxin
- 2735841..2735900 + 60 NuclAT_31 - Antitoxin
- 2735841..2735900 + 60 NuclAT_31 - Antitoxin
- 2735841..2735900 + 60 NuclAT_31 - Antitoxin
- 2735841..2735900 + 60 NuclAT_33 - Antitoxin
- 2735841..2735900 + 60 NuclAT_33 - Antitoxin
- 2735841..2735900 + 60 NuclAT_33 - Antitoxin
- 2735841..2735900 + 60 NuclAT_33 - Antitoxin
ILQ37_RS13885 2736192..2737292 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
ILQ37_RS13890 2737562..2737792 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ILQ37_RS13895 2737953..2738648 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
ILQ37_RS13900 2738692..2739045 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
ILQ37_RS13905 2739231..2740625 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T176288 WP_000170963.1 NZ_CP062761:c2735793-2735686 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T176288 NZ_CP082775:c4795480-4795373 [Escherichia coli O25:H4]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT176288 NZ_CP062761:2735841-2735900 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References