Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4826388..4826800 | Replicon | chromosome |
Accession | NZ_CP062755 | ||
Organism | Escherichia coli O157:H7 strain Z903 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | ILQ39_RS24155 | Protein ID | WP_000132630.1 |
Coordinates | 4826459..4826800 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4826388..4826464 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ39_RS24145 | 4823015..4824484 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
ILQ39_RS24150 | 4824484..4826238 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
- | 4826388..4826464 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4826388..4826464 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4826388..4826464 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4826388..4826464 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4826388..4826464 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4826388..4826464 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4826388..4826464 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4826388..4826464 | - | 77 | NuclAT_15 | - | Antitoxin |
ILQ39_RS24155 | 4826459..4826800 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
ILQ39_RS24160 | 4826847..4828010 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
ILQ39_RS24165 | 4828058..4828939 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
ILQ39_RS24170 | 4829036..4829200 | - | 165 | WP_000394274.1 | DUF1127 domain-containing protein | - |
ILQ39_RS24175 | 4829377..4830789 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
ILQ39_RS24180 | 4831032..4831232 | - | 201 | WP_001310455.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | espX6 | 4818587..4839814 | 21227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T176228 WP_000132630.1 NZ_CP062755:4826459-4826800 [Escherichia coli O157:H7]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
>T176228 NZ_CP082772:c4901273-4901166 [Escherichia coli O2:H1]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 77 bp
>AT176228 NZ_CP062755:c4826464-4826388 [Escherichia coli O157:H7]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|