Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2462633..2462858 | Replicon | chromosome |
| Accession | NZ_CP062755 | ||
| Organism | Escherichia coli O157:H7 strain Z903 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | ILQ39_RS12210 | Protein ID | WP_000813258.1 |
| Coordinates | 2462633..2462788 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2462800..2462858 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILQ39_RS12160 | 2457636..2458067 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| ILQ39_RS12175 | 2458518..2459231 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| ILQ39_RS12180 | 2459367..2459564 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| ILQ39_RS12185 | 2459789..2460343 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| ILQ39_RS12190 | 2460406..2460711 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ILQ39_RS12195 | 2460724..2461773 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| ILQ39_RS12200 | 2461775..2462047 | - | 273 | WP_000191872.1 | hypothetical protein | - |
| ILQ39_RS12205 | 2462169..2462513 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| ILQ39_RS12210 | 2462633..2462788 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 2462800..2462858 | + | 59 | - | - | Antitoxin |
| ILQ39_RS12215 | 2463079..2463636 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| ILQ39_RS12220 | 2463638..2463856 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| ILQ39_RS12225 | 2463984..2464295 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| ILQ39_RS12230 | 2464288..2464515 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| ILQ39_RS12235 | 2464512..2464793 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| ILQ39_RS12240 | 2464826..2465542 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| ILQ39_RS12245 | 2465576..2466037 | - | 462 | WP_000139447.1 | replication protein | - |
| ILQ39_RS12250 | 2466030..2467073 | - | 1044 | WP_001262402.1 | hypothetical protein | - |
| ILQ39_RS12255 | 2467142..2467567 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| ILQ39_RS12260 | 2467551..2467793 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleC / nleG7' / paa | 2378407..2525028 | 146621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T176208 WP_000813258.1 NZ_CP062755:c2462788-2462633 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T176208 NZ_CP082772:482737-482910 [Escherichia coli O2:H1]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTTCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTTCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 59 bp
>AT176208 NZ_CP062755:2462800-2462858 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|