Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3571339..3571564 | Replicon | chromosome |
| Accession | NZ_CP062746 | ||
| Organism | Escherichia coli O157:H7 strain Z1504 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | ILQ42_RS18345 | Protein ID | WP_000813263.1 |
| Coordinates | 3571339..3571494 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3571506..3571564 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILQ42_RS18310 | 3566793..3567506 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| ILQ42_RS18315 | 3567644..3567840 | - | 197 | Protein_3585 | TrmB family transcriptional regulator | - |
| ILQ42_RS18320 | 3568127..3568945 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| ILQ42_RS18325 | 3569097..3569468 | - | 372 | WP_000090264.1 | antitermination protein | - |
| ILQ42_RS18330 | 3569458..3569829 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ILQ42_RS18335 | 3569842..3570891 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| ILQ42_RS18340 | 3570893..3571171 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| ILQ42_RS18345 | 3571339..3571494 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3571506..3571564 | + | 59 | - | - | Antitoxin |
| ILQ42_RS18350 | 3572099..3572872 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| ILQ42_RS18355 | 3573224..3573637 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| ILQ42_RS18360 | 3573653..3574423 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| ILQ42_RS18365 | 3574445..3575191 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
| ILQ42_RS18370 | 3575198..3576289 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T176112 WP_000813263.1 NZ_CP062746:c3571494-3571339 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T176112 NZ_CP082357:2602223-2602330 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT176112 NZ_CP062746:3571506-3571564 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|