Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2598286..2598500 Replicon chromosome
Accession NZ_CP062746
Organism Escherichia coli O157:H7 strain Z1504

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ILQ42_RS13200 Protein ID WP_000170963.1
Coordinates 2598286..2598393 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2598441..2598500 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ILQ42_RS13170 2593595..2594677 + 1083 WP_000804726.1 peptide chain release factor 1 -
ILQ42_RS13175 2594677..2595510 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
ILQ42_RS13180 2595507..2595899 + 393 WP_000200380.1 invasion regulator SirB2 -
ILQ42_RS13185 2595903..2596712 + 810 WP_001257044.1 invasion regulator SirB1 -
ILQ42_RS13190 2596748..2597602 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
ILQ42_RS13195 2597750..2597857 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2597910..2597971 + 62 NuclAT_24 - -
- 2597910..2597971 + 62 NuclAT_24 - -
- 2597910..2597971 + 62 NuclAT_24 - -
- 2597910..2597971 + 62 NuclAT_24 - -
- 2597910..2597971 + 62 NuclAT_26 - -
- 2597910..2597971 + 62 NuclAT_26 - -
- 2597910..2597971 + 62 NuclAT_26 - -
- 2597910..2597971 + 62 NuclAT_26 - -
- 2597910..2597971 + 62 NuclAT_28 - -
- 2597910..2597971 + 62 NuclAT_28 - -
- 2597910..2597971 + 62 NuclAT_28 - -
- 2597910..2597971 + 62 NuclAT_28 - -
- 2597910..2597971 + 62 NuclAT_30 - -
- 2597910..2597971 + 62 NuclAT_30 - -
- 2597910..2597971 + 62 NuclAT_30 - -
- 2597910..2597971 + 62 NuclAT_30 - -
- 2597910..2597971 + 62 NuclAT_32 - -
- 2597910..2597971 + 62 NuclAT_32 - -
- 2597910..2597971 + 62 NuclAT_32 - -
- 2597910..2597971 + 62 NuclAT_32 - -
- 2597910..2597972 + 63 NuclAT_17 - -
- 2597910..2597972 + 63 NuclAT_17 - -
- 2597910..2597972 + 63 NuclAT_17 - -
- 2597910..2597972 + 63 NuclAT_17 - -
- 2597910..2597972 + 63 NuclAT_18 - -
- 2597910..2597972 + 63 NuclAT_18 - -
- 2597910..2597972 + 63 NuclAT_18 - -
- 2597910..2597972 + 63 NuclAT_18 - -
- 2597910..2597972 + 63 NuclAT_19 - -
- 2597910..2597972 + 63 NuclAT_19 - -
- 2597910..2597972 + 63 NuclAT_19 - -
- 2597910..2597972 + 63 NuclAT_19 - -
- 2597910..2597972 + 63 NuclAT_20 - -
- 2597910..2597972 + 63 NuclAT_20 - -
- 2597910..2597972 + 63 NuclAT_20 - -
- 2597910..2597972 + 63 NuclAT_20 - -
- 2597910..2597972 + 63 NuclAT_22 - -
- 2597910..2597972 + 63 NuclAT_22 - -
- 2597910..2597972 + 63 NuclAT_22 - -
- 2597910..2597972 + 63 NuclAT_22 - -
- 2597910..2597972 + 63 NuclAT_23 - -
- 2597910..2597972 + 63 NuclAT_23 - -
- 2597910..2597972 + 63 NuclAT_23 - -
- 2597910..2597972 + 63 NuclAT_23 - -
ILQ42_RS13200 2598286..2598393 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2598441..2598500 + 60 NuclAT_25 - Antitoxin
- 2598441..2598500 + 60 NuclAT_25 - Antitoxin
- 2598441..2598500 + 60 NuclAT_25 - Antitoxin
- 2598441..2598500 + 60 NuclAT_25 - Antitoxin
- 2598441..2598500 + 60 NuclAT_27 - Antitoxin
- 2598441..2598500 + 60 NuclAT_27 - Antitoxin
- 2598441..2598500 + 60 NuclAT_27 - Antitoxin
- 2598441..2598500 + 60 NuclAT_27 - Antitoxin
- 2598441..2598500 + 60 NuclAT_29 - Antitoxin
- 2598441..2598500 + 60 NuclAT_29 - Antitoxin
- 2598441..2598500 + 60 NuclAT_29 - Antitoxin
- 2598441..2598500 + 60 NuclAT_29 - Antitoxin
- 2598441..2598500 + 60 NuclAT_31 - Antitoxin
- 2598441..2598500 + 60 NuclAT_31 - Antitoxin
- 2598441..2598500 + 60 NuclAT_31 - Antitoxin
- 2598441..2598500 + 60 NuclAT_31 - Antitoxin
- 2598441..2598500 + 60 NuclAT_33 - Antitoxin
- 2598441..2598500 + 60 NuclAT_33 - Antitoxin
- 2598441..2598500 + 60 NuclAT_33 - Antitoxin
- 2598441..2598500 + 60 NuclAT_33 - Antitoxin
ILQ42_RS13205 2598792..2599892 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
ILQ42_RS13210 2600162..2600392 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ILQ42_RS13215 2600553..2601248 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
ILQ42_RS13220 2601292..2601645 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
ILQ42_RS13225 2601831..2603225 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T176098 WP_000170963.1 NZ_CP062746:c2598393-2598286 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T176098 NZ_CP082355:4105413-4105754 [Escherichia coli]
ATGACTGACATGCATTCTATTGCACAACCGTTCGAAGCAGAAGTCTCCCCGGCAAATAACCGTCAATTAACCGTGAGTTA
TGCGAGCCGCTACCCGGATTACAGCCGTATTCCCGCCATCACCCTGAAAGGTCAGTGGCTGGAAACCGCCGGTTTTGCCA
CCGGCACGCCCGTTAATGTCAAAGTGATGGAAGGCTGTATTGTCCTCACCGCCCAACCACCCGCCGCCGAAGAGAGCGAG
CTAATGCAGTCGCTGCGCCAGGTGTGCAAGCTGTCGGCGCGTAAACAAAAGCAGGTGCAGGAGTTTATTGGGGTGATTGC
GGGTAAACAAAAAGTCGCCTGA

Antitoxin


Download         Length: 60 bp

>AT176098 NZ_CP062746:2598441-2598500 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References