Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2644825..2645050 | Replicon | chromosome |
Accession | NZ_CP062742 | ||
Organism | Escherichia coli O157:H7 strain Z1626 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | ILQ44_RS13435 | Protein ID | WP_000813258.1 |
Coordinates | 2644895..2645050 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2644825..2644883 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ44_RS13385 | 2639890..2640132 | + | 243 | WP_000747948.1 | hypothetical protein | - |
ILQ44_RS13390 | 2640116..2640541 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
ILQ44_RS13395 | 2640610..2641653 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
ILQ44_RS13400 | 2641646..2642107 | + | 462 | WP_000139447.1 | replication protein | - |
ILQ44_RS13405 | 2642141..2642857 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
ILQ44_RS13410 | 2642890..2643171 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
ILQ44_RS13415 | 2643168..2643395 | + | 228 | WP_000699809.1 | hypothetical protein | - |
ILQ44_RS13420 | 2643388..2643699 | + | 312 | WP_001289673.1 | hypothetical protein | - |
ILQ44_RS13425 | 2643827..2644045 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
ILQ44_RS13430 | 2644047..2644604 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2644825..2644883 | - | 59 | - | - | Antitoxin |
ILQ44_RS13435 | 2644895..2645050 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
ILQ44_RS13440 | 2645170..2645514 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
ILQ44_RS13445 | 2645636..2645908 | + | 273 | WP_000191872.1 | hypothetical protein | - |
ILQ44_RS13450 | 2645910..2646959 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
ILQ44_RS13455 | 2646972..2647277 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ44_RS13460 | 2647340..2647894 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
ILQ44_RS13465 | 2648119..2648316 | + | 198 | WP_000917763.1 | hypothetical protein | - |
ILQ44_RS13470 | 2648452..2649165 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
ILQ44_RS13485 | 2649616..2650047 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' / nleC | 2577838..2729755 | 151917 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T176032 WP_000813258.1 NZ_CP062742:2644895-2645050 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T176032 NZ_CP082341:c3717407-3717108 [Pantoea dispersa]
ATGATTGAGGATGTGTTGGCCAGCCTGGCGGTTCTCAGGGCGTTCGGGCCCACGTTAGGGCGGCCTGATGTTGATACCCT
CGTCGGGTCGCGTTTTTCCAATATGAAAGAACTCCGTGTTCAGAGTAATGGCCGGGCGATTCGTGCGTTTTTTGCCTTCG
ATCCGGTCAGACGGGCCATTGTGCTCTGCGCGGGAAACAAAACCGGAACGCATCAGCGGCGCTTTTATCAGGCGATGATT
AAACTGGCTGACCGCGAGTATCAACAGCATCTGGAGGAGATGAATCATGCCAAAACTTGA
ATGATTGAGGATGTGTTGGCCAGCCTGGCGGTTCTCAGGGCGTTCGGGCCCACGTTAGGGCGGCCTGATGTTGATACCCT
CGTCGGGTCGCGTTTTTCCAATATGAAAGAACTCCGTGTTCAGAGTAATGGCCGGGCGATTCGTGCGTTTTTTGCCTTCG
ATCCGGTCAGACGGGCCATTGTGCTCTGCGCGGGAAACAAAACCGGAACGCATCAGCGGCGCTTTTATCAGGCGATGATT
AAACTGGCTGACCGCGAGTATCAACAGCATCTGGAGGAGATGAATCATGCCAAAACTTGA
Antitoxin
Download Length: 59 bp
>AT176032 NZ_CP062742:c2644883-2644825 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|