Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2208810..2209024 | Replicon | chromosome |
| Accession | NZ_CP062739 | ||
| Organism | Escherichia coli O157:H7 strain Z1723 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | ILQ45_RS11075 | Protein ID | WP_000170963.1 |
| Coordinates | 2208810..2208917 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2208965..2209024 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILQ45_RS11045 | 2204119..2205201 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| ILQ45_RS11050 | 2205201..2206034 | + | 834 | WP_000456466.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| ILQ45_RS11055 | 2206031..2206423 | + | 393 | WP_000200380.1 | invasion regulator SirB2 | - |
| ILQ45_RS11060 | 2206427..2207236 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| ILQ45_RS11065 | 2207272..2208126 | + | 855 | WP_000811067.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| ILQ45_RS11070 | 2208274..2208381 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2208434..2208495 | + | 62 | NuclAT_30 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_30 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_30 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_30 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_34 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_34 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_34 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_34 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_38 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_38 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_38 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_38 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_42 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_42 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_42 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_42 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_46 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_46 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_46 | - | - |
| - | 2208434..2208495 | + | 62 | NuclAT_46 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_17 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_17 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_17 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_17 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_19 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_19 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_19 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_19 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_21 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_21 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_21 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_21 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_23 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_23 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_23 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_23 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_26 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_26 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_26 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_26 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_28 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_28 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_28 | - | - |
| - | 2208434..2208496 | + | 63 | NuclAT_28 | - | - |
| ILQ45_RS11075 | 2208810..2208917 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
| - | 2208965..2209024 | + | 60 | NuclAT_32 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_32 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_32 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_32 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_36 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_36 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_36 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_36 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_40 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_40 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_40 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_40 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_44 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_44 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_44 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_44 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_48 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_48 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_48 | - | Antitoxin |
| - | 2208965..2209024 | + | 60 | NuclAT_48 | - | Antitoxin |
| ILQ45_RS11080 | 2209316..2210416 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
| ILQ45_RS11085 | 2210686..2210916 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| ILQ45_RS11090 | 2211077..2211772 | + | 696 | WP_001301489.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| ILQ45_RS11095 | 2211816..2212169 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| ILQ45_RS11100 | 2212355..2213749 | + | 1395 | WP_000086192.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T175984 WP_000170963.1 NZ_CP062739:c2208917-2208810 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T175984 NZ_CP082317:1336959-1337246 [Vibrio alginolyticus]
ATGAAAGTAGTTTGGTCTCCATTAGCGCTTCAAAAGTTAGGCGATGCAGCGGAGTTCATTTCTTTGGATAACCCACCTGC
GGCAGAAAAGTGGGTAAACGAAGTTTTTGATAAAACTGAACTACTTGGAAGTATGCCTGAGATGGGGCGCTTTGTTCCTG
AAATACCTCATACGAATTATCGTGAAATTATTTTTGGTCACTATCGTATTATCTACAGCTTAAGTCATGAAATCCGCGTG
CTAACAGTTCGTAATTGTCGTCAAATGTTGTCGGAAGATGATGTGTAA
ATGAAAGTAGTTTGGTCTCCATTAGCGCTTCAAAAGTTAGGCGATGCAGCGGAGTTCATTTCTTTGGATAACCCACCTGC
GGCAGAAAAGTGGGTAAACGAAGTTTTTGATAAAACTGAACTACTTGGAAGTATGCCTGAGATGGGGCGCTTTGTTCCTG
AAATACCTCATACGAATTATCGTGAAATTATTTTTGGTCACTATCGTATTATCTACAGCTTAAGTCATGAAATCCGCGTG
CTAACAGTTCGTAATTGTCGTCAAATGTTGTCGGAAGATGATGTGTAA
Antitoxin
Download Length: 60 bp
>AT175984 NZ_CP062739:2208965-2209024 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|