Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2208810..2209024 Replicon chromosome
Accession NZ_CP062739
Organism Escherichia coli O157:H7 strain Z1723

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ILQ45_RS11075 Protein ID WP_000170963.1
Coordinates 2208810..2208917 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2208965..2209024 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ILQ45_RS11045 2204119..2205201 + 1083 WP_000804726.1 peptide chain release factor 1 -
ILQ45_RS11050 2205201..2206034 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
ILQ45_RS11055 2206031..2206423 + 393 WP_000200380.1 invasion regulator SirB2 -
ILQ45_RS11060 2206427..2207236 + 810 WP_001257044.1 invasion regulator SirB1 -
ILQ45_RS11065 2207272..2208126 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
ILQ45_RS11070 2208274..2208381 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2208434..2208495 + 62 NuclAT_30 - -
- 2208434..2208495 + 62 NuclAT_30 - -
- 2208434..2208495 + 62 NuclAT_30 - -
- 2208434..2208495 + 62 NuclAT_30 - -
- 2208434..2208495 + 62 NuclAT_34 - -
- 2208434..2208495 + 62 NuclAT_34 - -
- 2208434..2208495 + 62 NuclAT_34 - -
- 2208434..2208495 + 62 NuclAT_34 - -
- 2208434..2208495 + 62 NuclAT_38 - -
- 2208434..2208495 + 62 NuclAT_38 - -
- 2208434..2208495 + 62 NuclAT_38 - -
- 2208434..2208495 + 62 NuclAT_38 - -
- 2208434..2208495 + 62 NuclAT_42 - -
- 2208434..2208495 + 62 NuclAT_42 - -
- 2208434..2208495 + 62 NuclAT_42 - -
- 2208434..2208495 + 62 NuclAT_42 - -
- 2208434..2208495 + 62 NuclAT_46 - -
- 2208434..2208495 + 62 NuclAT_46 - -
- 2208434..2208495 + 62 NuclAT_46 - -
- 2208434..2208495 + 62 NuclAT_46 - -
- 2208434..2208496 + 63 NuclAT_17 - -
- 2208434..2208496 + 63 NuclAT_17 - -
- 2208434..2208496 + 63 NuclAT_17 - -
- 2208434..2208496 + 63 NuclAT_17 - -
- 2208434..2208496 + 63 NuclAT_19 - -
- 2208434..2208496 + 63 NuclAT_19 - -
- 2208434..2208496 + 63 NuclAT_19 - -
- 2208434..2208496 + 63 NuclAT_19 - -
- 2208434..2208496 + 63 NuclAT_21 - -
- 2208434..2208496 + 63 NuclAT_21 - -
- 2208434..2208496 + 63 NuclAT_21 - -
- 2208434..2208496 + 63 NuclAT_21 - -
- 2208434..2208496 + 63 NuclAT_23 - -
- 2208434..2208496 + 63 NuclAT_23 - -
- 2208434..2208496 + 63 NuclAT_23 - -
- 2208434..2208496 + 63 NuclAT_23 - -
- 2208434..2208496 + 63 NuclAT_26 - -
- 2208434..2208496 + 63 NuclAT_26 - -
- 2208434..2208496 + 63 NuclAT_26 - -
- 2208434..2208496 + 63 NuclAT_26 - -
- 2208434..2208496 + 63 NuclAT_28 - -
- 2208434..2208496 + 63 NuclAT_28 - -
- 2208434..2208496 + 63 NuclAT_28 - -
- 2208434..2208496 + 63 NuclAT_28 - -
ILQ45_RS11075 2208810..2208917 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2208965..2209024 + 60 NuclAT_32 - Antitoxin
- 2208965..2209024 + 60 NuclAT_32 - Antitoxin
- 2208965..2209024 + 60 NuclAT_32 - Antitoxin
- 2208965..2209024 + 60 NuclAT_32 - Antitoxin
- 2208965..2209024 + 60 NuclAT_36 - Antitoxin
- 2208965..2209024 + 60 NuclAT_36 - Antitoxin
- 2208965..2209024 + 60 NuclAT_36 - Antitoxin
- 2208965..2209024 + 60 NuclAT_36 - Antitoxin
- 2208965..2209024 + 60 NuclAT_40 - Antitoxin
- 2208965..2209024 + 60 NuclAT_40 - Antitoxin
- 2208965..2209024 + 60 NuclAT_40 - Antitoxin
- 2208965..2209024 + 60 NuclAT_40 - Antitoxin
- 2208965..2209024 + 60 NuclAT_44 - Antitoxin
- 2208965..2209024 + 60 NuclAT_44 - Antitoxin
- 2208965..2209024 + 60 NuclAT_44 - Antitoxin
- 2208965..2209024 + 60 NuclAT_44 - Antitoxin
- 2208965..2209024 + 60 NuclAT_48 - Antitoxin
- 2208965..2209024 + 60 NuclAT_48 - Antitoxin
- 2208965..2209024 + 60 NuclAT_48 - Antitoxin
- 2208965..2209024 + 60 NuclAT_48 - Antitoxin
ILQ45_RS11080 2209316..2210416 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
ILQ45_RS11085 2210686..2210916 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ILQ45_RS11090 2211077..2211772 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
ILQ45_RS11095 2211816..2212169 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
ILQ45_RS11100 2212355..2213749 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T175984 WP_000170963.1 NZ_CP062739:c2208917-2208810 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T175984 NZ_CP082317:1336959-1337246 [Vibrio alginolyticus]
ATGAAAGTAGTTTGGTCTCCATTAGCGCTTCAAAAGTTAGGCGATGCAGCGGAGTTCATTTCTTTGGATAACCCACCTGC
GGCAGAAAAGTGGGTAAACGAAGTTTTTGATAAAACTGAACTACTTGGAAGTATGCCTGAGATGGGGCGCTTTGTTCCTG
AAATACCTCATACGAATTATCGTGAAATTATTTTTGGTCACTATCGTATTATCTACAGCTTAAGTCATGAAATCCGCGTG
CTAACAGTTCGTAATTGTCGTCAAATGTTGTCGGAAGATGATGTGTAA

Antitoxin


Download         Length: 60 bp

>AT175984 NZ_CP062739:2208965-2209024 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References