Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2645888..2646113 | Replicon | chromosome |
Accession | NZ_CP062731 | ||
Organism | Escherichia coli O157:H7 strain Z1768 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | ILQ48_RS13425 | Protein ID | WP_000813258.1 |
Coordinates | 2645958..2646113 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2645888..2645946 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ48_RS13375 | 2640953..2641195 | + | 243 | WP_000747948.1 | hypothetical protein | - |
ILQ48_RS13380 | 2641179..2641604 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
ILQ48_RS13385 | 2641673..2642716 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
ILQ48_RS13390 | 2642709..2643170 | + | 462 | WP_000139447.1 | replication protein | - |
ILQ48_RS13395 | 2643204..2643920 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
ILQ48_RS13400 | 2643953..2644234 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
ILQ48_RS13405 | 2644231..2644458 | + | 228 | WP_000699809.1 | hypothetical protein | - |
ILQ48_RS13410 | 2644451..2644762 | + | 312 | WP_001289673.1 | hypothetical protein | - |
ILQ48_RS13415 | 2644890..2645108 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
ILQ48_RS13420 | 2645110..2645667 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2645888..2645946 | - | 59 | - | - | Antitoxin |
ILQ48_RS13425 | 2645958..2646113 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
ILQ48_RS13430 | 2646233..2646577 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
ILQ48_RS13435 | 2646699..2646971 | + | 273 | WP_000191872.1 | hypothetical protein | - |
ILQ48_RS13440 | 2646973..2648022 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
ILQ48_RS13445 | 2648035..2648340 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ48_RS13450 | 2648403..2648957 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
ILQ48_RS13455 | 2649182..2649379 | + | 198 | WP_000917763.1 | hypothetical protein | - |
ILQ48_RS13460 | 2649515..2650228 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
ILQ48_RS13475 | 2650679..2651110 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleG7' / nleC | 2586409..2729029 | 142620 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T175883 WP_000813258.1 NZ_CP062731:2645958-2646113 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T175883 NZ_CP082236:975229-975483 [Pseudomonas sp. SC3(2021)]
TTGAAAGACATCATCGGCAAAGGCCGAATCATCTCCAGACTTCGAGCAGCCGAACATGGCAACTTTGGCGATTACGGTTT
TGTCGGTGACACCGTTTACGAAATGCGTGTTCACTACGGTCCTGGTTACAGGATGTCCTTCACTCGTCGAGACGACGTGA
TTTATCTGCTTTTGATCGGGGGCGATAAATCGACACAACGGCGTGATATCAAGCGCGCCGTACAAATGGCACATAGCATC
GGTAATGAGGAGTAA
TTGAAAGACATCATCGGCAAAGGCCGAATCATCTCCAGACTTCGAGCAGCCGAACATGGCAACTTTGGCGATTACGGTTT
TGTCGGTGACACCGTTTACGAAATGCGTGTTCACTACGGTCCTGGTTACAGGATGTCCTTCACTCGTCGAGACGACGTGA
TTTATCTGCTTTTGATCGGGGGCGATAAATCGACACAACGGCGTGATATCAAGCGCGCCGTACAAATGGCACATAGCATC
GGTAATGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT175883 NZ_CP062731:c2645946-2645888 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|