Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2642148..2642373 Replicon chromosome
Accession NZ_CP062727
Organism Escherichia coli O157:H7 strain Z1812

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag ILQ51_RS13415 Protein ID WP_000813258.1
Coordinates 2642218..2642373 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2642148..2642206 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ILQ51_RS13365 2637213..2637455 + 243 WP_000747948.1 hypothetical protein -
ILQ51_RS13370 2637439..2637864 + 426 WP_000693878.1 Rha family transcriptional regulator -
ILQ51_RS13375 2637933..2638976 + 1044 WP_001262402.1 hypothetical protein -
ILQ51_RS13380 2638969..2639430 + 462 WP_000139447.1 replication protein -
ILQ51_RS13385 2639464..2640180 + 717 WP_000450627.1 DUF1627 domain-containing protein -
ILQ51_RS13390 2640213..2640494 + 282 WP_000603384.1 DNA-binding protein -
ILQ51_RS13395 2640491..2640718 + 228 WP_000699809.1 hypothetical protein -
ILQ51_RS13400 2640711..2641022 + 312 WP_001289673.1 hypothetical protein -
ILQ51_RS13405 2641150..2641368 + 219 WP_000683609.1 DUF4014 family protein -
ILQ51_RS13410 2641370..2641927 + 558 WP_000104474.1 DUF551 domain-containing protein -
- 2642148..2642206 - 59 - - Antitoxin
ILQ51_RS13415 2642218..2642373 + 156 WP_000813258.1 type I toxin-antitoxin system Hok family toxin Toxin
ILQ51_RS13420 2642493..2642837 + 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
ILQ51_RS13425 2642959..2643231 + 273 WP_000191872.1 hypothetical protein -
ILQ51_RS13430 2643233..2644282 + 1050 WP_001265229.1 DUF968 domain-containing protein -
ILQ51_RS13435 2644295..2644600 + 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
ILQ51_RS13440 2644663..2645217 + 555 WP_000640035.1 DUF1133 family protein -
ILQ51_RS13445 2645442..2645639 + 198 WP_000917763.1 hypothetical protein -
ILQ51_RS13450 2645775..2646488 + 714 WP_000301797.1 helix-turn-helix domain-containing protein -
ILQ51_RS13465 2646939..2647370 + 432 WP_001302123.1 tellurite resistance protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - nleG7' / nleC 2575161..2725057 149896


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T175812 WP_000813258.1 NZ_CP062727:2642218-2642373 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T175812 NZ_CP082211:1990404-1990506 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 59 bp

>AT175812 NZ_CP062727:c2642206-2642148 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References