Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3226313..3226538 | Replicon | chromosome |
Accession | NZ_CP062719 | ||
Organism | Escherichia coli O157:H7 strain Z1816 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | ILQ55_RS16430 | Protein ID | WP_000813258.1 |
Coordinates | 3226313..3226468 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3226480..3226538 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ55_RS16380 | 3221316..3221747 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
ILQ55_RS16395 | 3222198..3222911 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
ILQ55_RS16400 | 3223047..3223244 | - | 198 | WP_000917763.1 | hypothetical protein | - |
ILQ55_RS16405 | 3223469..3224023 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
ILQ55_RS16410 | 3224086..3224391 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ55_RS16415 | 3224404..3225453 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
ILQ55_RS16420 | 3225455..3225727 | - | 273 | WP_000191872.1 | hypothetical protein | - |
ILQ55_RS16425 | 3225849..3226193 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
ILQ55_RS16430 | 3226313..3226468 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 3226480..3226538 | + | 59 | - | - | Antitoxin |
ILQ55_RS16435 | 3226759..3227316 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
ILQ55_RS16440 | 3227318..3227536 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
ILQ55_RS16445 | 3227664..3227975 | - | 312 | WP_001289673.1 | hypothetical protein | - |
ILQ55_RS16450 | 3227968..3228195 | - | 228 | WP_000699809.1 | hypothetical protein | - |
ILQ55_RS16455 | 3228192..3228473 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
ILQ55_RS16460 | 3228506..3229222 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
ILQ55_RS16465 | 3229256..3229717 | - | 462 | WP_000139447.1 | replication protein | - |
ILQ55_RS16470 | 3229710..3230753 | - | 1044 | WP_001262402.1 | hypothetical protein | - |
ILQ55_RS16475 | 3230822..3231247 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
ILQ55_RS16480 | 3231231..3231473 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 3181343..3288854 | 107511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T175669 WP_000813258.1 NZ_CP062719:c3226468-3226313 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T175669 NZ_CP082127:c4168842-4168555 [Escherichia coli]
ATGCCAATGGAGTTTGAATGGGATGAAAACAAGGCCAAAAGTAATCGGGTGAAACATGGCATCCGCTTTGAAGATGCGGT
GTTATTGTTTGATGATCCACAACATTTGTCACAGCAAGAACGCATAGAAAACGGTGAGTATCGCTGGCAGACAATCGGCC
TGGTTTACGGCATCGTGGTTATTCTGGTTGCGCATACCATCCGTTTCGAAAGCGGAAATGAAATTATTCGAATCATCAGT
GCACGAAAAGCAGATCGTAAAGAGAGGAATCGCTATGAGCATGGTTAA
ATGCCAATGGAGTTTGAATGGGATGAAAACAAGGCCAAAAGTAATCGGGTGAAACATGGCATCCGCTTTGAAGATGCGGT
GTTATTGTTTGATGATCCACAACATTTGTCACAGCAAGAACGCATAGAAAACGGTGAGTATCGCTGGCAGACAATCGGCC
TGGTTTACGGCATCGTGGTTATTCTGGTTGCGCATACCATCCGTTTCGAAAGCGGAAATGAAATTATTCGAATCATCAGT
GCACGAAAAGCAGATCGTAAAGAGAGGAATCGCTATGAGCATGGTTAA
Antitoxin
Download Length: 59 bp
>AT175669 NZ_CP062719:3226480-3226538 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|