Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3613068..3613293 | Replicon | chromosome |
| Accession | NZ_CP062717 | ||
| Organism | Escherichia coli O157:H7 strain Z1825 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | ILQ56_RS18655 | Protein ID | WP_000813263.1 |
| Coordinates | 3613068..3613223 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3613235..3613293 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILQ56_RS18620 | 3608522..3609235 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| ILQ56_RS18625 | 3609373..3609569 | - | 197 | Protein_3645 | TrmB family transcriptional regulator | - |
| ILQ56_RS18630 | 3609856..3610674 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| ILQ56_RS18635 | 3610826..3611197 | - | 372 | WP_000090264.1 | antitermination protein | - |
| ILQ56_RS18640 | 3611187..3611558 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ILQ56_RS18645 | 3611571..3612620 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| ILQ56_RS18650 | 3612622..3612900 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| ILQ56_RS18655 | 3613068..3613223 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| ILQ56_RS18660 | 3613828..3614601 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| ILQ56_RS18665 | 3614953..3615366 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| ILQ56_RS18670 | 3615382..3616152 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| ILQ56_RS18675 | 3616174..3616920 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
| ILQ56_RS18680 | 3616927..3618018 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T175636 WP_000813263.1 NZ_CP062717:c3613223-3613068 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T175636 NZ_CP082120:2696061-2696168 [Escherichia coli]
ATGACGCTCGCGCAGTTTACCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTACCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT175636 NZ_CP062717:3613235-3613293 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|