Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2693523..2693748 | Replicon | chromosome |
Accession | NZ_CP062713 | ||
Organism | Escherichia coli O157:H7 strain Z1830 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | ILQ58_RS13725 | Protein ID | WP_000813258.1 |
Coordinates | 2693593..2693748 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2693523..2693581 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ58_RS13675 | 2688588..2688830 | + | 243 | WP_000747948.1 | hypothetical protein | - |
ILQ58_RS13680 | 2688814..2689239 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
ILQ58_RS13685 | 2689308..2690351 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
ILQ58_RS13690 | 2690344..2690805 | + | 462 | WP_000139447.1 | replication protein | - |
ILQ58_RS13695 | 2690839..2691555 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
ILQ58_RS13700 | 2691588..2691869 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
ILQ58_RS13705 | 2691866..2692093 | + | 228 | WP_000699809.1 | hypothetical protein | - |
ILQ58_RS13710 | 2692086..2692397 | + | 312 | WP_001289673.1 | hypothetical protein | - |
ILQ58_RS13715 | 2692525..2692743 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
ILQ58_RS13720 | 2692745..2693302 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2693523..2693581 | - | 59 | - | - | Antitoxin |
ILQ58_RS13725 | 2693593..2693748 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
ILQ58_RS13730 | 2693868..2694212 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
ILQ58_RS13735 | 2694334..2694606 | + | 273 | WP_000191872.1 | hypothetical protein | - |
ILQ58_RS13740 | 2694608..2695657 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
ILQ58_RS13745 | 2695670..2695975 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ58_RS13750 | 2696038..2696592 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
ILQ58_RS13755 | 2696817..2697014 | + | 198 | WP_000917763.1 | hypothetical protein | - |
ILQ58_RS13760 | 2697150..2697863 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
ILQ58_RS13775 | 2698314..2698745 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleG7' / nleC | 2631849..2738568 | 106719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T175559 WP_000813258.1 NZ_CP062713:2693593-2693748 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T175559 NZ_CP082028:c5185-4871 [Klebsiella pneumoniae]
ATGCCACAGGTAACGATTTCCGCGCTGGCACAGCGCGATTTACAACGCCTTCAGGACTTTCTCAAAACCAAAAATCGGCT
GGCAGCCAGAAAAGGAGGTGAGGTGATCGTCCGGGCTATCCAGCAACTGAAAACATTGCCAGACATTGGCCGCCCGGTGC
CGTTTCTGCCGCTGGAATATAAGGAACTGGTGATCGGGTTTGGCGACAGTGGCTATGTGATGCTCTACCGCCACGACCGG
GAAATGGACCAGATTGTGATCGTCACCGTCAGGCATCAGAAAGAATCCGGGTATCCGGGGGCAGACAGCCTCTAA
ATGCCACAGGTAACGATTTCCGCGCTGGCACAGCGCGATTTACAACGCCTTCAGGACTTTCTCAAAACCAAAAATCGGCT
GGCAGCCAGAAAAGGAGGTGAGGTGATCGTCCGGGCTATCCAGCAACTGAAAACATTGCCAGACATTGGCCGCCCGGTGC
CGTTTCTGCCGCTGGAATATAAGGAACTGGTGATCGGGTTTGGCGACAGTGGCTATGTGATGCTCTACCGCCACGACCGG
GAAATGGACCAGATTGTGATCGTCACCGTCAGGCATCAGAAAGAATCCGGGTATCCGGGGGCAGACAGCCTCTAA
Antitoxin
Download Length: 59 bp
>AT175559 NZ_CP062713:c2693581-2693523 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|