Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2694840..2695065 | Replicon | chromosome |
Accession | NZ_CP062705 | ||
Organism | Escherichia coli O157:H7 strain Z1833 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | ILQ61_RS13730 | Protein ID | WP_000813258.1 |
Coordinates | 2694910..2695065 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2694840..2694898 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ61_RS13680 | 2689905..2690147 | + | 243 | WP_000747948.1 | hypothetical protein | - |
ILQ61_RS13685 | 2690131..2690556 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
ILQ61_RS13690 | 2690625..2691668 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
ILQ61_RS13695 | 2691661..2692122 | + | 462 | WP_000139447.1 | replication protein | - |
ILQ61_RS13700 | 2692156..2692872 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
ILQ61_RS13705 | 2692905..2693186 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
ILQ61_RS13710 | 2693183..2693410 | + | 228 | WP_000699809.1 | hypothetical protein | - |
ILQ61_RS13715 | 2693403..2693714 | + | 312 | WP_001289673.1 | hypothetical protein | - |
ILQ61_RS13720 | 2693842..2694060 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
ILQ61_RS13725 | 2694062..2694619 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2694840..2694898 | - | 59 | - | - | Antitoxin |
ILQ61_RS13730 | 2694910..2695065 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
ILQ61_RS13735 | 2695185..2695529 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
ILQ61_RS13740 | 2695651..2695923 | + | 273 | WP_000191872.1 | hypothetical protein | - |
ILQ61_RS13745 | 2695925..2696974 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
ILQ61_RS13750 | 2696987..2697292 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ61_RS13755 | 2697355..2697909 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
ILQ61_RS13760 | 2698134..2698331 | + | 198 | WP_000917763.1 | hypothetical protein | - |
ILQ61_RS13765 | 2698467..2699180 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
ILQ61_RS13780 | 2699631..2700062 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleG7' / nleC | 2625447..2739885 | 114438 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T175447 WP_000813258.1 NZ_CP062705:2694910-2695065 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T175447 NZ_CP081987:c2124767-2124498 [Shinella oryzae]
TTGGCCTGGGCGATTGAGATCACCGAAGGGGCTAAGAAAGAGCTCGATAAACTCGGTCATGTCGAGGCAAAGCGCATTCG
TAATTTTCTTGTCACGAAGCTTGCTTCCTCGGAAAATCCTCGTCTGCTGGGCAGCGCTTTGCAGGGCGCGCGGCTGGGAA
GCTATTGGCGGTATCGCGTTGGCGACTATCGGATCATTTGTGACATCCAGGACAACAGGCTTGTCGTGGTCGTCGTTCGT
GTAGGACATCGGCGTGAAATATATTCCTGA
TTGGCCTGGGCGATTGAGATCACCGAAGGGGCTAAGAAAGAGCTCGATAAACTCGGTCATGTCGAGGCAAAGCGCATTCG
TAATTTTCTTGTCACGAAGCTTGCTTCCTCGGAAAATCCTCGTCTGCTGGGCAGCGCTTTGCAGGGCGCGCGGCTGGGAA
GCTATTGGCGGTATCGCGTTGGCGACTATCGGATCATTTGTGACATCCAGGACAACAGGCTTGTCGTGGTCGTCGTTCGT
GTAGGACATCGGCGTGAAATATATTCCTGA
Antitoxin
Download Length: 59 bp
>AT175447 NZ_CP062705:c2694898-2694840 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|