Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3496889..3497114 | Replicon | chromosome |
Accession | NZ_CP062700 | ||
Organism | Escherichia coli O157:H7 strain Z1835 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | ILQ63_RS17895 | Protein ID | WP_000813263.1 |
Coordinates | 3496889..3497044 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3497056..3497114 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILQ63_RS17860 | 3492343..3493056 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
ILQ63_RS17865 | 3493194..3493390 | - | 197 | Protein_3500 | TrmB family transcriptional regulator | - |
ILQ63_RS17870 | 3493677..3494495 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
ILQ63_RS17875 | 3494647..3495018 | - | 372 | WP_000090264.1 | antitermination protein | - |
ILQ63_RS17880 | 3495008..3495379 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
ILQ63_RS17885 | 3495392..3496441 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
ILQ63_RS17890 | 3496443..3496721 | - | 279 | WP_001341388.1 | hypothetical protein | - |
ILQ63_RS17895 | 3496889..3497044 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3497056..3497114 | + | 59 | - | - | Antitoxin |
ILQ63_RS17900 | 3497649..3498422 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
ILQ63_RS17905 | 3498774..3499187 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
ILQ63_RS17910 | 3499203..3499973 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
ILQ63_RS17915 | 3499995..3500741 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
ILQ63_RS17920 | 3500748..3501857 | - | 1110 | WP_021499850.1 | putative primosomal protein I | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T175378 WP_000813263.1 NZ_CP062700:c3497044-3496889 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T175378 NZ_CP081894:4016667-4016885 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 59 bp
>AT175378 NZ_CP062700:3497056-3497114 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|