Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2561364..2561589 | Replicon | chromosome |
| Accession | NZ_CP062700 | ||
| Organism | Escherichia coli O157:H7 strain Z1835 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | ILQ63_RS12905 | Protein ID | WP_000813254.1 |
| Coordinates | 2561434..2561589 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2561364..2561422 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILQ63_RS12860 | 2556617..2557570 | + | 954 | WP_000095667.1 | helix-turn-helix domain-containing protein | - |
| ILQ63_RS12865 | 2557577..2558317 | + | 741 | WP_206356613.1 | ATP-binding protein | - |
| ILQ63_RS12870 | 2558347..2559117 | + | 771 | WP_000450888.1 | DUF1627 domain-containing protein | - |
| ILQ63_RS12875 | 2559133..2559528 | + | 396 | WP_001118161.1 | DUF977 family protein | - |
| ILQ63_RS12880 | 2559585..2559941 | + | 357 | WP_001302146.1 | hypothetical protein | - |
| ILQ63_RS12885 | 2559990..2560202 | + | 213 | WP_000063625.1 | hypothetical protein | - |
| ILQ63_RS12890 | 2560238..2560609 | + | 372 | WP_000137941.1 | hypothetical protein | - |
| ILQ63_RS12895 | 2560606..2560968 | + | 363 | WP_000610379.1 | DUF551 domain-containing protein | - |
| ILQ63_RS12900 | 2561084..2561188 | + | 105 | WP_001278450.1 | hypothetical protein | - |
| - | 2561364..2561422 | - | 59 | - | - | Antitoxin |
| ILQ63_RS12905 | 2561434..2561589 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| ILQ63_RS12910 | 2561868..2562035 | + | 168 | WP_000998188.1 | hypothetical protein | - |
| ILQ63_RS12915 | 2562101..2562379 | + | 279 | WP_001304183.1 | hypothetical protein | - |
| ILQ63_RS12920 | 2562381..2563430 | + | 1050 | WP_001302870.1 | DUF968 domain-containing protein | - |
| ILQ63_RS12925 | 2563443..2563817 | + | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ILQ63_RS12930 | 2563814..2564635 | + | 822 | WP_000762904.1 | antitermination protein | - |
| ILQ63_RS12935 | 2564862..2565059 | + | 198 | WP_000917735.1 | hypothetical protein | - |
| ILQ63_RS12940 | 2565210..2566268 | + | 1059 | WP_000483497.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleA/espI | 2541269..2599496 | 58227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T175372 WP_000813254.1 NZ_CP062700:2561434-2561589 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T175372 NZ_CP081893:c4746461-4746222 [Klebsiella quasipneumoniae]
ATGACCTATGAACTGGCGTTTGATCCGCGTGCCTGGCGCGAATGGCAGAAGCTTGGCGAGACGATCAAAAAACAGTTCAA
AAATAAGCTCCAGCAGGTTGTGCAGAATCCGCGAATTGCATCGGCCAGTCTGAGTGATTTACCGGATTGCTACAAAATCA
AGCTTAAGGCGTCAGGTTATCGGTTGGTGTATCAAGTACGGGATAGTGTGGTGGTGGTTTACGTTATTGCCAGTGGCTAA
ATGACCTATGAACTGGCGTTTGATCCGCGTGCCTGGCGCGAATGGCAGAAGCTTGGCGAGACGATCAAAAAACAGTTCAA
AAATAAGCTCCAGCAGGTTGTGCAGAATCCGCGAATTGCATCGGCCAGTCTGAGTGATTTACCGGATTGCTACAAAATCA
AGCTTAAGGCGTCAGGTTATCGGTTGGTGTATCAAGTACGGGATAGTGTGGTGGTGGTTTACGTTATTGCCAGTGGCTAA
Antitoxin
Download Length: 59 bp
>AT175372 NZ_CP062700:c2561422-2561364 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|