Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 559165..559349 | Replicon | chromosome |
Accession | NZ_CP062469 | ||
Organism | Staphylococcus aureus strain MRSA - AMRF 4 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | ILP76_RS02530 | Protein ID | WP_000482647.1 |
Coordinates | 559165..559272 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 559289..559349 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ILP76_RS02505 | 554537..555010 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
ILP76_RS02510 | 555133..556344 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
ILP76_RS02515 | 556526..557185 | - | 660 | WP_000831298.1 | membrane protein | - |
ILP76_RS02520 | 557245..558387 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
ILP76_RS02525 | 558645..559031 | + | 387 | WP_000779347.1 | flippase GtxA | - |
ILP76_RS02530 | 559165..559272 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 559289..559349 | - | 61 | - | - | Antitoxin |
ILP76_RS02535 | 559900..561663 | + | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
ILP76_RS02540 | 561688..563421 | + | 1734 | WP_000486491.1 | ABC transporter ATP-binding protein/permease | - |
ILP76_RS02545 | 563652..563819 | + | 168 | WP_001792506.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T175305 WP_000482647.1 NZ_CP062469:559165-559272 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T175305 NZ_CP081881:c2754733-2754631 [Escherichia coli]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT175305 NZ_CP062469:c559349-559289 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|