Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 199433..199589 | Replicon | chromosome |
| Accession | NZ_CP062469 | ||
| Organism | Staphylococcus aureus strain MRSA - AMRF 4 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | ILP76_RS00860 | Protein ID | WP_099560939.1 |
| Coordinates | 199433..199528 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 199553..199589 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILP76_RS00835 | 195597..197225 | + | 1629 | WP_061642462.1 | recombinase family protein | - |
| ILP76_RS00840 | 197730..198080 | + | 351 | WP_061544230.1 | hypothetical protein | - |
| ILP76_RS00845 | 198167..198478 | + | 312 | WP_061544231.1 | hypothetical protein | - |
| ILP76_RS00850 | 198493..198996 | + | 504 | WP_037559702.1 | DUF1643 domain-containing protein | - |
| ILP76_RS00855 | 199011..199232 | + | 222 | WP_061544232.1 | hypothetical protein | - |
| ILP76_RS00860 | 199433..199528 | + | 96 | WP_099560939.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 199553..199589 | - | 37 | - | - | Antitoxin |
| ILP76_RS00865 | 199898..200851 | - | 954 | WP_194085652.1 | restriction endonuclease subunit S | - |
| ILP76_RS00870 | 201090..202259 | - | 1170 | Protein_173 | IS256 family transposase | - |
| ILP76_RS00875 | 202461..204017 | - | 1557 | WP_194085653.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 198167..208066 | 9899 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3503.15 Da Isoelectric Point: 7.9875
>T175302 WP_099560939.1 NZ_CP062469:199433-199528 [Staphylococcus aureus]
MADILVNIMTTAASGCIVALFSYWLRKRDDK
MADILVNIMTTAASGCIVALFSYWLRKRDDK
Download Length: 96 bp
>T175302 NZ_CP081881:c2147328-2147221 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 37 bp
>AT175302 NZ_CP062469:c199589-199553 [Staphylococcus aureus]
ATGCACCAATCCCCTCACTACTGCCATAGTGAGGGGA
ATGCACCAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|