Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1821096..1821276 | Replicon | chromosome |
| Accession | NZ_CP062467 | ||
| Organism | Staphylococcus aureus strain MRSA - AMRF 5 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | ILP77_RS09130 | Protein ID | WP_001801861.1 |
| Coordinates | 1821181..1821276 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1821096..1821153 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILP77_RS09115 | 1816697..1817962 | + | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
| ILP77_RS09120 | 1818001..1818855 | + | 855 | WP_001069960.1 | DNA adenine methylase | - |
| ILP77_RS09125 | 1818833..1820530 | + | 1698 | WP_000447924.1 | hypothetical protein | - |
| - | 1821096..1821153 | + | 58 | - | - | Antitoxin |
| ILP77_RS09130 | 1821181..1821276 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| ILP77_RS09135 | 1821728..1822174 | + | 447 | WP_000747808.1 | DUF1433 domain-containing protein | - |
| ILP77_RS09140 | 1822358..1822915 | + | 558 | WP_000864141.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ILP77_RS09145 | 1823047..1823799 | - | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
| ILP77_RS09150 | 1823826..1824569 | - | 744 | WP_174840254.1 | exotoxin | - |
| ILP77_RS09155 | 1824596..1825222 | - | 627 | WP_000669025.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1799735..1827781 | 28046 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T175291 WP_001801861.1 NZ_CP062467:c1821276-1821181 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T175291 NZ_CP081881:267718-267825 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT175291 NZ_CP062467:1821096-1821153 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|