Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 183492..183672 | Replicon | chromosome |
Accession | NZ_CP062419 | ||
Organism | Staphylococcus aureus strain NAS_AN_023 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | IF697_RS01140 | Protein ID | WP_001801861.1 |
Coordinates | 183577..183672 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 183492..183549 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF697_RS01110 | 179843..180961 | + | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
IF697_RS01115 | 181609..182025 | + | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
IF697_RS01120 | 182331..182609 | + | 279 | WP_001798632.1 | DUF1433 domain-containing protein | - |
IF697_RS01125 | 182631..183005 | + | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
IF697_RS01130 | 183193..183375 | + | 183 | Protein_187 | transposase | - |
IF697_RS01135 | 183353..183454 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 183492..183549 | + | 58 | - | - | Antitoxin |
IF697_RS01140 | 183577..183672 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
IF697_RS01145 | 184123..184569 | + | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
IF697_RS01150 | 185254..185637 | + | 384 | WP_000070811.1 | hypothetical protein | - |
IF697_RS01155 | 185648..185824 | + | 177 | WP_000375476.1 | hypothetical protein | - |
IF697_RS01160 | 186124..186752 | + | 629 | Protein_193 | ImmA/IrrE family metallo-endopeptidase | - |
IF697_RS01165 | 186950..187522 | - | 573 | WP_000414206.1 | hypothetical protein | - |
IF697_RS01170 | 187623..187964 | - | 342 | WP_000627547.1 | DUF3969 family protein | - |
IF697_RS01175 | 188005..188631 | - | 627 | WP_000669021.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / hlgA / lukD | 154597..220281 | 65684 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T175201 WP_001801861.1 NZ_CP062419:c183672-183577 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T175201 NZ_CP081816:1187554-1187772 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 58 bp
>AT175201 NZ_CP062419:183492-183549 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|