Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2292499..2292683 | Replicon | chromosome |
Accession | NZ_CP062418 | ||
Organism | Staphylococcus aureus strain NAS_AN_136 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | IF715_RS11230 | Protein ID | WP_000482647.1 |
Coordinates | 2292499..2292606 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2292623..2292683 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF715_RS11205 | 2287871..2288344 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
IF715_RS11210 | 2288467..2289678 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
IF715_RS11215 | 2289860..2290519 | - | 660 | WP_000831298.1 | membrane protein | - |
IF715_RS11220 | 2290579..2291721 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
IF715_RS11225 | 2291979..2292365 | + | 387 | WP_000779360.1 | flippase GtxA | - |
IF715_RS11230 | 2292499..2292606 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2292623..2292683 | - | 61 | - | - | Antitoxin |
IF715_RS11235 | 2293310..2295073 | + | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein | - |
IF715_RS11240 | 2295098..2296831 | + | 1734 | WP_000486489.1 | ABC transporter ATP-binding protein | - |
IF715_RS11245 | 2297062..2297229 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T175191 WP_000482647.1 NZ_CP062418:2292499-2292606 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T175191 NZ_CP081813:2693709-2693816 [Shigella flexneri]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT175191 NZ_CP062418:c2292683-2292623 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|