Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2294969..2295153 | Replicon | chromosome |
Accession | NZ_CP062417 | ||
Organism | Staphylococcus aureus strain NAS_AN_143 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | IF718_RS11160 | Protein ID | WP_000482652.1 |
Coordinates | 2294969..2295076 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2295093..2295153 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF718_RS11135 | 2290331..2290804 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
IF718_RS11140 | 2290927..2292138 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
IF718_RS11145 | 2292320..2292979 | - | 660 | WP_000831298.1 | membrane protein | - |
IF718_RS11150 | 2293039..2294181 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
IF718_RS11155 | 2294449..2294835 | + | 387 | WP_000779360.1 | flippase GtxA | - |
IF718_RS11160 | 2294969..2295076 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2295093..2295153 | - | 61 | - | - | Antitoxin |
IF718_RS11165 | 2295779..2297542 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
IF718_RS11170 | 2297567..2299300 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
IF718_RS11175 | 2299567..2299698 | + | 132 | WP_223197975.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T175176 WP_000482652.1 NZ_CP062417:2294969-2295076 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T175176 NZ_CP081791:2803454-2803561 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT175176 NZ_CP062417:c2295153-2295093 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|