Detailed information of TA system TA175038

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 2730704..2731118
• Replicon: chromosome
• Accession: NZ_CP062409
• Organism: Staphylococcus aureus strain NAS_AN_239

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: IF734_RS13475
• Protein ID: WP_001065046.1
• Coordinates: 2730704..2730955 (+)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: IF734_RS13480
• Protein ID: WP_000028424.1
• Coordinates: 2730945..2731118 (+)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
IF734_RS13435 (2726361)	2726361..2727281	+	921	WP_000138475.1	recombinase RecT	-
IF734_RS13440 (2727362)	2727362..2727979	+	618	WP_072353921.1	MBL fold metallo-hydrolase	-
IF734_RS13445 (2727980)	2727980..2728450	+	471	WP_000934762.1	single-stranded DNA-binding protein	-
IF734_RS13450 (2728480)	2728480..2729373	+	894	WP_000148327.1	DnaD domain-containing protein	-
IF734_RS13455 (2729380)	2729380..2729598	+	219	WP_000338527.1	hypothetical protein	-
IF734_RS13460 (2729607)	2729607..2730062	+	456	WP_000401965.1	RusA family crossover junction endodeoxyribonuclease	-
IF734_RS13465 (2730075)	2730075..2730443	+	369	WP_000101270.1	SA1788 family PVL leukocidin-associated protein	-
IF734_RS13470 (2730447)	2730447..2730689	+	243	WP_000131381.1	phi PVL orf 51-like protein	-
IF734_RS13475 (2730704)	2730704..2730955	+	252	WP_001065046.1	DUF1024 family protein	Toxin
IF734_RS13480 (2730945)	2730945..2731118	+	174	WP_000028424.1	hypothetical protein	Antitoxin
IF734_RS13485 (2731207)	2731207..2731401	+	195	WP_231119680.1	hypothetical protein	-
IF734_RS13490 (2731402)	2731402..2731563	+	162	WP_000889682.1	hypothetical protein	-
IF734_RS13495 (2731578)	2731578..2732111	+	534	WP_001061838.1	dUTPase	-
IF734_RS13500 (2732148)	2732148..2732393	+	246	WP_001282074.1	hypothetical protein	-
IF734_RS13505 (2732390)	2732390..2732596	+	207	WP_000195803.1	DUF1381 domain-containing protein	-
IF734_RS13510 (2732593)	2732593..2732979	+	387	WP_000592201.1	hypothetical protein	-
IF734_RS13515 (2732976)	2732976..2733125	+	150	WP_000595305.1	transcriptional activator RinB	-
IF734_RS13520 (2733284)	2733284..2733934	+	651	WP_001005262.1	hypothetical protein	-
IF734_RS13525 (2733934)	2733934..2734134	+	201	WP_000265041.1	DUF1514 family protein	-
IF734_RS13530 (2734157)	2734157..2734627	+	471	WP_000282758.1	hypothetical protein	-
IF734_RS13535 (2734742)	2734742..2735194	+	453	WP_000406191.1	nucleoside triphosphate pyrophosphohydrolase family protein	-
IF734_RS13540 (2735210)	2735210..2735554	+	345	WP_000817289.1	HNH endonuclease	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	groEL / hlb	2708445..2736149	27704

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9377.26 Da
• Isoelectric Point: 3.7128

>T175038 WP_001065046.1 NZ_CP062409:2730704-2730955 [Staphylococcus aureus]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Nucleotide

• Length: 252 bp

>T175038 NZ_CP081742:2907172-2907279 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6468.29 Da
• Isoelectric Point: 4.2484

>AT175038 WP_000028424.1 NZ_CP062409:2730945-2731118 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp

>AT175038 NZ_CP081742:c2907122-2907059 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT