Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1611535..1611715 | Replicon | chromosome |
Accession | NZ_CP062405 | ||
Organism | Staphylococcus aureus strain NAS_NP_209 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | IF754_RS08030 | Protein ID | WP_001801861.1 |
Coordinates | 1611535..1611630 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1611658..1611715 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF754_RS08000 | 1606679..1607305 | + | 627 | WP_000669038.1 | hypothetical protein | - |
IF754_RS08005 | 1607346..1607690 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
IF754_RS08010 | 1607788..1608360 | + | 573 | WP_000414222.1 | hypothetical protein | - |
IF754_RS08015 | 1608509..1609876 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
IF754_RS08020 | 1609876..1610445 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
IF754_RS08025 | 1610638..1611084 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
IF754_RS08030 | 1611535..1611630 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1611658..1611715 | - | 58 | - | - | Antitoxin |
IF754_RS08035 | 1611753..1611854 | + | 102 | WP_001791232.1 | hypothetical protein | - |
IF754_RS08040 | 1612029..1612472 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
IF754_RS08045 | 1612472..1612915 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
IF754_RS08050 | 1612915..1613357 | - | 443 | Protein_1585 | DUF1433 domain-containing protein | - |
IF754_RS08055 | 1613882..1616302 | + | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hysA | 1604120..1641478 | 37358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T174955 WP_001801861.1 NZ_CP062405:1611535-1611630 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T174955 NZ_CP081713:3668031-3668249 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTTTGGAAATTTATTCGCTAA
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTTTGGAAATTTATTCGCTAA
Antitoxin
Download Length: 58 bp
>AT174955 NZ_CP062405:c1611715-1611658 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|