Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2389739..2389923 | Replicon | chromosome |
Accession | NZ_CP062402 | ||
Organism | Staphylococcus aureus strain NAS_OP_056 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | IF766_RS11785 | Protein ID | WP_000482650.1 |
Coordinates | 2389816..2389923 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2389739..2389799 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF766_RS11770 (IF766_11705) | 2385249..2385416 | - | 168 | WP_001792506.1 | hypothetical protein | - |
IF766_RS11775 (IF766_11710) | 2385647..2387380 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
IF766_RS11780 (IF766_11715) | 2387405..2389168 | - | 1764 | WP_001064820.1 | ABC transporter ATP-binding protein | - |
- | 2389739..2389799 | + | 61 | - | - | Antitoxin |
IF766_RS11785 (IF766_11720) | 2389816..2389923 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
IF766_RS11790 (IF766_11725) | 2390057..2390443 | - | 387 | WP_000779358.1 | flippase GtxA | - |
IF766_RS11795 (IF766_11730) | 2390701..2391843 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
IF766_RS11800 (IF766_11735) | 2391903..2392562 | + | 660 | WP_000831298.1 | membrane protein | - |
IF766_RS11805 (IF766_11740) | 2392744..2393955 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
IF766_RS11810 (IF766_11745) | 2394078..2394551 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T174913 WP_000482650.1 NZ_CP062402:c2389923-2389816 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T174913 NZ_CP081706:2803456-2803563 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT174913 NZ_CP062402:2389739-2389799 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|