Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2353322..2353506 | Replicon | chromosome |
Accession | NZ_CP062401 | ||
Organism | Staphylococcus aureus strain NAS_OP_098 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | IF770_RS11590 | Protein ID | WP_000482652.1 |
Coordinates | 2353322..2353429 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2353446..2353506 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF770_RS11565 | 2348684..2349157 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
IF770_RS11570 | 2349280..2350491 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
IF770_RS11575 | 2350673..2351332 | - | 660 | WP_000831298.1 | membrane protein | - |
IF770_RS11580 | 2351392..2352534 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
IF770_RS11585 | 2352802..2353188 | + | 387 | WP_000779360.1 | flippase GtxA | - |
IF770_RS11590 | 2353322..2353429 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2353446..2353506 | - | 61 | - | - | Antitoxin |
IF770_RS11595 | 2354132..2355895 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
IF770_RS11600 | 2355920..2357653 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
IF770_RS11605 | 2357920..2358051 | + | 132 | WP_223197975.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T174895 WP_000482652.1 NZ_CP062401:2353322-2353429 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T174895 NZ_CP081701:4072759-4072911 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 61 bp
>AT174895 NZ_CP062401:c2353506-2353446 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|