Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1246928..1247342 Replicon chromosome
Accession NZ_CP062399
Organism Staphylococcus aureus strain NAS_OP_143

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag IF777_RS06130 Protein ID WP_240053312.1
Coordinates 1246928..1247179 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag IF777_RS06135 Protein ID WP_000028424.1
Coordinates 1247169..1247342 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IF777_RS06060 (IF777_06035) 1242034..1242804 + 771 WP_000190224.1 conserved phage C-terminal domain-containing protein -
IF777_RS06065 (IF777_06040) 1242814..1243593 + 780 WP_031881362.1 ATP-binding protein -
IF777_RS06070 (IF777_06045) 1243587..1243745 + 159 WP_000256594.1 hypothetical protein -
IF777_RS06075 (IF777_06050) 1243758..1243979 + 222 WP_001123692.1 DUF3269 family protein -
IF777_RS06080 (IF777_06055) 1243990..1244394 + 405 WP_031881361.1 DUF1064 domain-containing protein -
IF777_RS06085 (IF777_06060) 1244399..1244584 + 186 WP_128415228.1 DUF3113 family protein -
IF777_RS06090 (IF777_06065) 1244585..1244944 + 360 WP_031881360.1 SA1788 family PVL leukocidin-associated protein -
IF777_RS06095 (IF777_06070) 1244944..1245201 + 258 WP_031881359.1 DUF3310 domain-containing protein -
IF777_RS06100 (IF777_06075) 1245204..1245404 + 201 WP_000235381.1 hypothetical protein -
IF777_RS06105 (IF777_06080) 1245413..1245661 + 249 WP_000178883.1 phi PVL orf 51-like protein -
IF777_RS06110 (IF777_06085) 1245676..1245882 + 207 WP_021285869.1 hypothetical protein -
IF777_RS06115 (IF777_06090) 1245885..1246286 + 402 WP_103147882.1 hypothetical protein -
IF777_RS06120 (IF777_06095) 1246283..1246630 + 348 WP_000979209.1 YopX family protein -
IF777_RS06125 (IF777_06100) 1246627..1246935 + 309 WP_000144708.1 hypothetical protein -
IF777_RS06130 (IF777_06105) 1246928..1247179 + 252 WP_240053312.1 DUF1024 family protein Toxin
IF777_RS06135 (IF777_06110) 1247169..1247342 + 174 WP_000028424.1 hypothetical protein Antitoxin
IF777_RS06140 (IF777_06115) 1247343..1247504 + 162 WP_000889684.1 hypothetical protein -
IF777_RS06145 (IF777_06120) 1247519..1248025 + 507 WP_240053313.1 dUTPase -
IF777_RS06150 (IF777_06125) 1248062..1248250 + 189 WP_050963983.1 DUF1381 domain-containing protein -
IF777_RS06155 (IF777_06130) 1248225..1248425 + 201 WP_001125015.1 hypothetical protein -
IF777_RS06160 (IF777_06135) 1248428..1248601 + 174 WP_001797333.1 transcriptional activator RinB -
IF777_RS06165 (IF777_06140) 1248602..1248967 + 366 WP_000455357.1 hypothetical protein -
IF777_RS06170 1248970..1249035 + 66 Protein_1208 hypothetical protein -
IF777_RS06175 (IF777_06145) 1249050..1249469 + 420 WP_000058632.1 transcriptional regulator -
IF777_RS06180 (IF777_06150) 1249656..1250096 + 441 WP_001003271.1 terminase small subunit -
IF777_RS06185 (IF777_06155) 1250083..1251360 + 1278 WP_000169944.1 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9493.42 Da        Isoelectric Point: 3.7666

>T174865 WP_240053312.1 NZ_CP062399:1246928-1247179 [Staphylococcus aureus]
MNNREKIEQSVISTSAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIDLDEAVGIMVSQVVYKYEEEQE
NEY

Download         Length: 252 bp

>T174865 NZ_CP081698:2752088-2752195 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT174865 WP_000028424.1 NZ_CP062399:1247169-1247342 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp

>AT174865 NZ_CP081698:c2752035-2751974 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References