Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 183322..183502 | Replicon | chromosome |
Accession | NZ_CP062386 | ||
Organism | Staphylococcus aureus strain NAS_AN_047 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | IF701_RS01130 | Protein ID | WP_001801861.1 |
Coordinates | 183407..183502 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 183322..183379 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF701_RS01100 | 179673..180791 | + | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
IF701_RS01105 | 181439..181855 | + | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
IF701_RS01110 | 182161..182439 | + | 279 | WP_001798632.1 | DUF1433 domain-containing protein | - |
IF701_RS01115 | 182461..182835 | + | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
IF701_RS01120 | 183023..183205 | + | 183 | Protein_185 | transposase | - |
IF701_RS01125 | 183183..183284 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 183322..183379 | + | 58 | - | - | Antitoxin |
IF701_RS01130 | 183407..183502 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
IF701_RS01135 | 183953..184399 | + | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
IF701_RS01140 | 185084..185467 | + | 384 | WP_000070811.1 | hypothetical protein | - |
IF701_RS01145 | 185478..185654 | + | 177 | WP_000375476.1 | hypothetical protein | - |
IF701_RS01150 | 185954..186582 | + | 629 | Protein_191 | ImmA/IrrE family metallo-endopeptidase | - |
IF701_RS01155 | 186780..187352 | - | 573 | WP_000414206.1 | hypothetical protein | - |
IF701_RS01160 | 187453..187794 | - | 342 | WP_000627547.1 | DUF3969 family protein | - |
IF701_RS01165 | 187835..188461 | - | 627 | WP_000669021.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / hlgA / lukD | 156351..220195 | 63844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T174771 WP_001801861.1 NZ_CP062386:c183502-183407 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T174771 NZ_CP081508:1944797-1944955 [Trueperella pyogenes]
GTGAAGATTCGGCAAACCGACGTGTATGCTCGCTGGTTTCGCAAGCTCAAAGATGTCCAGGGCACGGCCCGAATCAATAT
TGCACTTCAGCGTTGCAAAATAGCTGGCGAAGTAGTGGGTGACGTCAAGCCGGTTGGTGATGGCGTTTTTGAGATGTGA
GTGAAGATTCGGCAAACCGACGTGTATGCTCGCTGGTTTCGCAAGCTCAAAGATGTCCAGGGCACGGCCCGAATCAATAT
TGCACTTCAGCGTTGCAAAATAGCTGGCGAAGTAGTGGGTGACGTCAAGCCGGTTGGTGATGGCGTTTTTGAGATGTGA
Antitoxin
Download Length: 58 bp
>AT174771 NZ_CP062386:183322-183379 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|