Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2292652..2292836 | Replicon | chromosome |
Accession | NZ_CP062350 | ||
Organism | Staphylococcus aureus strain NAS_AN_250 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | IF736_RS11295 | Protein ID | WP_000482647.1 |
Coordinates | 2292652..2292759 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2292776..2292836 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF736_RS11270 | 2288024..2288497 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
IF736_RS11275 | 2288620..2289831 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
IF736_RS11280 | 2290013..2290672 | - | 660 | WP_000831298.1 | membrane protein | - |
IF736_RS11285 | 2290732..2291874 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
IF736_RS11290 | 2292132..2292518 | + | 387 | WP_000779360.1 | flippase GtxA | - |
IF736_RS11295 | 2292652..2292759 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2292776..2292836 | - | 61 | - | - | Antitoxin |
IF736_RS11300 | 2293387..2295150 | + | 1764 | WP_106905756.1 | ABC transporter ATP-binding protein | - |
IF736_RS11305 | 2295175..2296908 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
IF736_RS11310 | 2297139..2297306 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T174504 WP_000482647.1 NZ_CP062350:2292652-2292759 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T174504 NZ_CP081017:3871388-3871546 [Clostridioides difficile]
ATGGCAAATATAGTCAATTTTACTGACAAACAATTTGAAAATCGCTTAAATGATAATTTAGAAGAATTGGTTCAAGGAAA
AAAAGCGGTTGAATCGCCAACCGCTTTTTTACTTGGTGGGCAACCAGGGTCAGGGAAAACGAGTTTGCGAAGAAGATGA
ATGGCAAATATAGTCAATTTTACTGACAAACAATTTGAAAATCGCTTAAATGATAATTTAGAAGAATTGGTTCAAGGAAA
AAAAGCGGTTGAATCGCCAACCGCTTTTTTACTTGGTGGGCAACCAGGGTCAGGGAAAACGAGTTTGCGAAGAAGATGA
Antitoxin
Download Length: 61 bp
>AT174504 NZ_CP062350:c2292836-2292776 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|