Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1554478..1554660 | Replicon | chromosome |
| Accession | NZ_CP062348 | ||
| Organism | Staphylococcus aureus strain NAS_AN_260 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | IF738_RS07590 | Protein ID | WP_001801861.1 |
| Coordinates | 1554478..1554573 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1554601..1554660 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IF738_RS07555 | 1550148..1550774 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| IF738_RS07560 | 1550815..1551156 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| IF738_RS07565 | 1551257..1551829 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| IF738_RS07570 | 1552027..1552655 | - | 629 | Protein_1490 | ImmA/IrrE family metallo-endopeptidase | - |
| IF738_RS07575 | 1552958..1553134 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| IF738_RS07580 | 1553145..1553528 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| IF738_RS07585 | 1554132..1554275 | - | 144 | WP_001549059.1 | transposase | - |
| IF738_RS07590 | 1554478..1554573 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1554601..1554660 | - | 60 | - | - | Antitoxin |
| IF738_RS07595 | 1554696..1554797 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| IF738_RS07600 | 1554775..1554951 | - | 177 | Protein_1496 | transposase | - |
| IF738_RS07605 | 1555145..1555522 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T174480 WP_001801861.1 NZ_CP062348:1554478-1554573 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T174480 NZ_CP062348:1554478-1554573 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT174480 NZ_CP062348:c1554660-1554601 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|