Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 1725624..1726047 | Replicon | chromosome |
Accession | NZ_CP062346 | ||
Organism | Staphylococcus aureus strain NAS_AN_261 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | IF739_RS08620 | Protein ID | WP_086097839.1 |
Coordinates | 1725796..1726047 (-) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | IF739_RS08615 | Protein ID | WP_086097840.1 |
Coordinates | 1725624..1725806 (-) | Length | 61 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF739_RS08570 (1722238) | 1722238..1722705 | - | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
IF739_RS08575 (1722835) | 1722835..1723179 | - | 345 | WP_000817289.1 | HNH endonuclease | - |
IF739_RS08580 (1723195) | 1723195..1723647 | - | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
IF739_RS08585 (1723762) | 1723762..1724241 | - | 480 | WP_000282747.1 | hypothetical protein | - |
IF739_RS08590 (1724264) | 1724264..1724464 | - | 201 | WP_000265043.1 | DUF1514 family protein | - |
IF739_RS08595 (1724464) | 1724464..1724613 | - | 150 | WP_031761843.1 | transcriptional regulator | - |
IF739_RS08600 (1724610) | 1724610..1724816 | - | 207 | WP_031838300.1 | DUF1381 domain-containing protein | - |
IF739_RS08605 (1724813) | 1724813..1725058 | - | 246 | WP_001282070.1 | hypothetical protein | - |
IF739_RS08610 (1725095) | 1725095..1725631 | - | 537 | WP_000185680.1 | dUTPase | - |
IF739_RS08615 (1725624) | 1725624..1725806 | - | 183 | WP_086097840.1 | hypothetical protein | Antitoxin |
IF739_RS08620 (1725796) | 1725796..1726047 | - | 252 | WP_086097839.1 | DUF1024 family protein | Toxin |
IF739_RS08625 (1726040) | 1726040..1726315 | - | 276 | WP_072473441.1 | hypothetical protein | - |
IF739_RS08630 (1726315) | 1726315..1726722 | - | 408 | WP_000695734.1 | hypothetical protein | - |
IF739_RS08635 (1726737) | 1726737..1726985 | - | 249 | WP_115282690.1 | SAV1978 family virulence-associated passenger protein | - |
IF739_RS08640 (1726986) | 1726986..1727345 | - | 360 | WP_106459739.1 | SA1788 family PVL leukocidin-associated protein | - |
IF739_RS08645 (1727346) | 1727346..1727531 | - | 186 | WP_001187234.1 | DUF3113 family protein | - |
IF739_RS08650 (1727536) | 1727536..1727940 | - | 405 | WP_217767701.1 | DUF1064 domain-containing protein | - |
IF739_RS08655 (1727950) | 1727950..1728171 | - | 222 | WP_001123688.1 | DUF3269 family protein | - |
IF739_RS08660 (1728185) | 1728185..1728346 | - | 162 | WP_000237154.1 | hypothetical protein | - |
IF739_RS08665 (1728340) | 1728340..1729119 | - | 780 | WP_001668921.1 | ATP-binding protein | - |
IF739_RS08670 (1729129) | 1729129..1729899 | - | 771 | WP_001566734.1 | conserved phage C-terminal domain-containing protein | - |
IF739_RS08675 (1729964) | 1729964..1730719 | + | 756 | WP_240017877.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | geh | 1701852..1751326 | 49474 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9527.44 Da Isoelectric Point: 3.7128
>T174467 WP_086097839.1 NZ_CP062346:c1726047-1725796 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDIYKKAQAFDEILEGLPNAMQDALKEDIYLDEAVGIMTSQVVYKYEEEQE
NEY
MNNREQIEQSVISASAYNGNDTEGLLKEIEDIYKKAQAFDEILEGLPNAMQDALKEDIYLDEAVGIMTSQVVYKYEEEQE
NEY
Download Length: 252 bp
>T174467 NZ_CP081010:196821-196928 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 61 a.a. Molecular weight: 6793.71 Da Isoelectric Point: 4.4421
>AT174467 WP_086097840.1 NZ_CP062346:c1725806-1725624 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDIHYKLSDGSIISLIDFVIKPIHLIKEAQEND
MSISVGDKVYNHETNESLEIVQLVGDIRDIHYKLSDGSIISLIDFVIKPIHLIKEAQEND
Download Length: 183 bp
>AT174467 NZ_CP081010:c196772-196709 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|