Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2304591..2304775 | Replicon | chromosome |
Accession | NZ_CP062338 | ||
Organism | Staphylococcus aureus strain NAS_NP_103 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | IF745_RS11225 | Protein ID | WP_072467491.1 |
Coordinates | 2304591..2304698 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2304715..2304775 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF745_RS11200 | 2299964..2300437 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
IF745_RS11205 | 2300560..2301771 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
IF745_RS11210 | 2301953..2302612 | - | 660 | WP_000831298.1 | membrane protein | - |
IF745_RS11215 | 2302672..2303814 | - | 1143 | WP_001176873.1 | glycerate kinase | - |
IF745_RS11220 | 2304071..2304457 | + | 387 | WP_000779348.1 | flippase GtxA | - |
IF745_RS11225 | 2304591..2304698 | + | 108 | WP_072467491.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2304715..2304775 | - | 61 | - | - | Antitoxin |
IF745_RS11230 | 2305288..2307051 | + | 1764 | WP_001064834.1 | ABC transporter ATP-binding protein | - |
IF745_RS11235 | 2307076..2308809 | + | 1734 | WP_000486502.1 | ABC transporter ATP-binding protein | - |
IF745_RS11240 | 2309040..2309207 | + | 168 | WP_031866196.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3944.67 Da Isoelectric Point: 10.4934
>T174397 WP_072467491.1 NZ_CP062338:2304591-2304698 [Staphylococcus aureus]
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
Download Length: 108 bp
>T174397 NZ_CP081007:2761876-2761979 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT174397 NZ_CP062338:c2304775-2304715 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|